BDBM50139171 Dinaciclib::MK-7965::SCH-727965::US11643396, Example Dinaciclib::US20230416221, Compound Dinaciclib

SMILES CCc1cnn2c(NCc3ccc[n+]([O-])c3)cc(nc12)N1CCCC[C@H]1CCO

InChI Key InChIKey=PIMQWRZWLQKKBJ-UHFFFAOYSA-N

Data  3 KI  116 IC50  1 Kd

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 138 hits for monomerid = 50139171   

TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/2/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/2/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/25/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/25/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/15/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/25/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/18/2024
Entry Details
PubMed
TargetPlatelet-derived growth factor receptor alpha/beta(Mouse)
University of South Australia

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataKi:  1nMAssay Description:Inhibition of CDK2/cyclin E (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/21/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/15/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of human CDK2More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/19/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
TargetCyclin-dependent kinase 4(Human)
Csir-Indian Institute of Integrative Medicine

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5/p35 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/21/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/22/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/25/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/22/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5/p25 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate aft...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/2/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
9/7/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
9/7/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of Cdk5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/19/2024
Entry Details
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2/cyclin A (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrat...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/2/2018
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/19/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4(Human)
Csir-Indian Institute of Integrative Medicine

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin) expressed in Sf9 insect cells incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter met...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 9(Human)
Chinese Academy of Sciences

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK9 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 1.60nMAssay Description:Inhibition of full length N-terminal GST fused human CDK5(1 to 292 residues)/ p25 (99 to 307 residues) expressed in baculovirus expression system usi...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/7/2023
Entry Details Article
PubMed
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2nMAssay Description:Inhibition of His-tagged CDK2/Cyclin-E1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2021
Entry Details Article
PubMed
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin) expressed in sf9 cells using histone H1 as substrate in presence of [gamma33P]-ATPMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/9/2017
Entry Details Article
PubMed
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
TargetCyclin-dependent kinase 5(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2.10nMAssay Description:Inhibition of CDK5 (unknown origin) by FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/23/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 2.80nMAssay Description:Inhibition of CDK2 (unknown origin) using ULight 4EBP1 peptide as substrate incubated for 1 hr in presence of ATP by FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
TBA
Entry Details
Displayed 1 to 50 (of 138 total ) | Next | Last >>