BDBM50441588 CHEMBL2437159
SMILES O=C(COc1cccc2ccccc12)NNC(=S)NCCCCC1CCCCC1
InChI Key InChIKey=IOBCRLWDQPOVFD-UHFFFAOYSA-N
Data 2 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 2 hits for monomerid = 50441588
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 880nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair