Compile Data Set for Download or QSAR
maximum 50k data
Found 76 with Last Name = 'beinborn' and Initial = 'm'
TargetDipeptidyl peptidase 4(Homo sapiens (Human))
Tufts University

Curated by ChEMBL
LigandPNGBDBM50005111(CHEMBL3086656)
Affinity DataKi:  4.50E+3nMAssay Description:Competitive inhibition of human recombinant DPP4 using AP-pNA as substrate preincubated for 30 mins followed by substrate addition measured after 30 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDipeptidyl peptidase 4(Homo sapiens (Human))
Tufts University

Curated by ChEMBL
LigandPNGBDBM50005109(CHEMBL3086660)
Affinity DataKi:  5.00E+3nMAssay Description:Competitive inhibition of human recombinant DPP4 using AP-pNA as substrate preincubated for 30 mins followed by substrate addition measured after 30 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDipeptidyl peptidase 4(Homo sapiens (Human))
Tufts University

Curated by ChEMBL
LigandPNGBDBM50005107(CHEMBL3086661)
Affinity DataKi:  6.30E+3nMAssay Description:Competitive inhibition of human recombinant DPP4 using AP-pNA as substrate preincubated for 30 mins followed by substrate addition measured after 30 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDipeptidyl peptidase 4(Homo sapiens (Human))
Tufts University

Curated by ChEMBL
LigandPNGBDBM50005112(CHEMBL3086658)
Affinity DataKi:  6.10E+4nMAssay Description:Competitive inhibition of human recombinant DPP4 using AP-pNA as substrate preincubated for 30 mins followed by substrate addition measured after 30 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDipeptidyl peptidase 4(Homo sapiens (Human))
Tufts University

Curated by ChEMBL
LigandPNGBDBM50005110(CHEMBL3086657)
Affinity DataKi:  1.42E+5nMAssay Description:Competitive inhibition of human recombinant DPP4 using AP-pNA as substrate preincubated for 30 mins followed by substrate addition measured after 30 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273767(CHEMBL503693)
Affinity DataIC50:  1.40nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50152769(CHEMBL410972 | GLP-1(7-36)-NH2 | GLP-17-(7-36) der...)
Affinity DataIC50:  1.5nMAssay Description:Displacement of [125I]-exendin (9 to 39) from human GLP-1R expressed in African green monkey COS7 cells by liquid scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50152769(CHEMBL410972 | GLP-1(7-36)-NH2 | GLP-17-(7-36) der...)
Affinity DataIC50:  1.90nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275523(CHEMBL500187)
Affinity DataIC50:  5.10nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50442918(CHEMBL3086851)
Affinity DataIC50:  7.60nMAssay Description:Displacement of [125I]-exendin (9 to 39) from human GLP-1R expressed in African green monkey COS7 cells by liquid scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275527(CHEMBL524875)
Affinity DataIC50:  13nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273759(CHEMBL507591)
Affinity DataIC50:  15nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275526(CHEMBL506368)
Affinity DataIC50:  19nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50442919(CHEMBL3086852)
Affinity DataIC50:  36nMAssay Description:Displacement of [125I]-exendin (9 to 39) from human GLP-1R expressed in African green monkey COS7 cells by liquid scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275522(CHEMBL525224)
Affinity DataIC50:  52nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275528(CHEMBL525608)
Affinity DataIC50:  57nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275524(CHEMBL499397)
Affinity DataIC50:  107nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273753(CHEMBL524864)
Affinity DataIC50:  110nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50275525(CHEMBL527058)
Affinity DataIC50:  113nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataIC50:  210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataIC50:  210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273756(CHEMBL525424)
Affinity DataIC50:  229nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273754(CHEMBL526484)
Affinity DataIC50:  440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273754(CHEMBL526484)
Affinity DataIC50:  440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273762(CHEMBL525405)
Affinity DataIC50:  1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273762(CHEMBL525405)
Affinity DataIC50:  1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273764(CHEMBL500483)
Affinity DataIC50:  1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273764(CHEMBL500483)
Affinity DataIC50:  1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273761(CHEMBL502036)
Affinity DataIC50:  3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273761(CHEMBL502036)
Affinity DataIC50:  3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273763(CHEMBL525051)
Affinity DataIC50:  9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273763(CHEMBL525051)
Affinity DataIC50:  9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50442918(CHEMBL3086851)
Affinity DataEC50:  0.170nMAssay Description:Agonist activity at human GLP-1R expressed in African green monkey COS7 cells assessed as stimulation of cAMP productionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataEC50:  0.0120nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataEC50:  8.30nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataEC50:  0.00360nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273756(CHEMBL525424)
Affinity DataEC50:  15nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273753(CHEMBL524864)
Affinity DataEC50:  0.380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 76 total ) | Next | Last >>
Jump to: