Affinity DataKi: 0.0450nMAssay Description:Displacement of [3H]MPPF from 5HT1A receptor in Sprague-Dawley rat hippocampal membrane fraction incubated for 60 mins by scintillation counting meth...More data for this Ligand-Target Pair
TargetLow molecular weight phosphotyrosine protein phosphatase(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataKi: 1.20nMAssay Description:Competitive inhibition of LMW-PTP (unknown origin) assessed as inhibition constant by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of human AICARFTMore data for this Ligand-Target Pair
Affinity DataKi: 255nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 4.00E+3nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 6.50E+3nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 7.62E+3nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 2.79E+4nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 8.16E+4nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
Affinity DataKi: 1.36E+5nMAssay Description:Inhibition of Trypanosoma cruzi trypanothione reductase assessed as reduction of trypanothione disulfide by spectrophotometricallyMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 0.0600nMAssay Description:Inhibition of human PDE10AMore data for this Ligand-Target Pair
Affinity DataIC50: 0.5nMAssay Description:Inhibition of BTK (unknown origin) using ATP and Y5 Sox15 substrate mix incubated for 30 mins by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataIC50: <0.5nMAssay Description:Inhibition of BTK (unknown origin) using ATP and Y5 Sox15 substrate mix incubated for 30 mins by fluorescence based assayMore data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS-4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: <1nMAssay Description:Competitive inhibition against rat cytoplasmic thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Affinity DataIC50: 1.59nMAssay Description:The intrinsic potency for inhibition of KHK C or A activity may be measured using an enzymatic assay which measures the production of FIP. Compounds ...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Affinity DataIC50: 2.63nMAssay Description:The intrinsic potency for inhibition of KHK C or A activity may be measured using an enzymatic assay which measures the production of FIP. Compounds ...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS4 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS4 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS5 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS5 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS5 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetLow molecular weight phosphotyrosine protein phosphatase(Mus musculus)
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of N-terminal His-tagged full length mouse LMW-PTP expressed in Escherichia coli BL21(DE3) by SDS PAGE based mass spectrometry analysisMore data for this Ligand-Target Pair
TargetLow molecular weight phosphotyrosine protein phosphatase(Rattus norvegicus)
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of N-terminal His-tagged full length rat LMW-PTP expressed in Escherichia coli BL21(DE3)More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human ADAMTS5 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.58nMAssay Description:The intrinsic potency for inhibition of KHK C or A activity may be measured using an enzymatic assay which measures the production of FIP. Compounds ...More data for this Ligand-Target Pair
Affinity DataIC50: 3.63nMAssay Description:The intrinsic potency for inhibition of KHK C or A activity may be measured using an enzymatic assay which measures the production of FIP. Compounds ...More data for this Ligand-Target Pair
Affinity DataIC50: 3.65nMAssay Description:The intrinsic potency for inhibition of KHK C or A activity may be measured using an enzymatic assay which measures the production of FIP. Compounds ...More data for this Ligand-Target Pair