Compile Data Set for Download or QSAR
maximum 50k data
Found 4308 with Last Name = 'xi' and Initial = 's'
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50245852(CHEMBL458333 | N3-(2,6-dimethylphenyl)-1-(3-methox...)
Affinity DataKi:  0.0400nMAssay Description:Inhibition of LCK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50246967(CHEMBL4080228 | US10570121, Example 81)
Affinity DataKi: <0.100nMAssay Description:Binding affinity to EZH2 (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)
Affinity DataKi:  0.111nMAssay Description:Inhibition of human PI3KgammaMore data for this Ligand-Target Pair
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)
Affinity DataKi:  0.122nMAssay Description:Inhibition of human PI3KdeltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)
Affinity DataKi:  0.130nMAssay Description:Inhibition of human PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteasome subunit beta type-5(Homo sapiens (Human))
The University Of Melbourne

Curated by ChEMBL
LigandPNGBDBM50550643(CHEMBL4749207)
Affinity DataKi:  0.130nMAssay Description:Binding affinity to human 20S constitutive proteasome beta 5 subunit assessed as equilibrium constant using fluorogenic peptide Ac-WLA-AMC as substra...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM50428109(CHEMBL2331668 | US8791131, 259)
Affinity DataKi:  0.191nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50421256(CHEMBL2087874)
Affinity DataKi:  0.200nMAssay Description:Inhibition of N-terminal His6-tagged ACK1 expressed in baculovirus infected Hi5 cells assessed as inhibition of autophosphorylation after 2 hrs by EL...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428109(CHEMBL2331668 | US8791131, 259)
Affinity DataKi:  0.243nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50245852(CHEMBL458333 | N3-(2,6-dimethylphenyl)-1-(3-methox...)
Affinity DataKi:  0.25nMAssay Description:Inhibition of BTK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)
Affinity DataKi:  0.299nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50421257(CHEMBL2087875)
Affinity DataKi:  0.300nMAssay Description:Inhibition of N-terminal His6-tagged ACK1 expressed in baculovirus infected Hi5 cells assessed as inhibition of autophosphorylation after 2 hrs by EL...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50421255(CHEMBL2087873)
Affinity DataKi:  0.300nMAssay Description:Inhibition of N-terminal His6-tagged ACK1 expressed in baculovirus infected Hi5 cells assessed as inhibition of autophosphorylation after 2 hrs by EL...More data for this Ligand-Target Pair
LigandPNGBDBM50380320(CHEMBL2017653)
Affinity DataKi:  0.350nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428111(CHEMBL2331666 | US8791131, 153)
Affinity DataKi:  0.377nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428108(CHEMBL2331669 | US8791131, 255)
Affinity DataKi:  0.395nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428113(CHEMBL2331663 | US8791131, 172)
Affinity DataKi:  0.532nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428115(CHEMBL2331661 | US8791131, 136)
Affinity DataKi:  0.542nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50380313(CHEMBL1234354 | US8633204, 286)
Affinity DataKi:  0.570nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
LigandPNGBDBM50428110(CHEMBL2331667 | US8791131, 254)
Affinity DataKi:  0.584nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50380321(CHEMBL2017654)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428113(CHEMBL2331663 | US8791131, 172)
Affinity DataKi:  0.842nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428111(CHEMBL2331666 | US8791131, 153)
Affinity DataKi:  0.922nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetApoptosis regulator Bcl-2(Homo sapiens (Human))
Dalian University Of Technology

Curated by ChEMBL
LigandPNGBDBM21447(4-(4-{[2-(4-chlorophenyl)phenyl]methyl}piperazin-1...)
Affinity DataKi:  1nMAssay Description:Binding affinity to Bcl-2 (unknown origin) fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428117(CHEMBL2331657)
Affinity DataKi:  1.40nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)
Affinity DataKi:  1.40nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428110(CHEMBL2331667 | US8791131, 254)
Affinity DataKi:  1.60nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHeat shock protein HSP 90-alpha/90-beta(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM20800(2-amino-6-halopurine analogue, 20 | 6-chloro-9-[(4...)
Affinity DataKi:  1.70nMAssay Description:Inhibition of recombinant His-tagged full length human HSP90 (9 to 236 residues) expressed in Escherichia coli BL21(DE3) cells after 18 hrs by fluore...More data for this Ligand-Target Pair
LigandPNGBDBM50380314(CHEMBL2017648)
Affinity DataKi:  1.70nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50380315(CHEMBL2017649)
Affinity DataKi:  1.80nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50246162(CHEMBL472392 | N3-(2,6-dimethylphenyl)-1-(3-methox...)
Affinity DataKi:  2nMAssay Description:Inhibition of histidine-tagged ACK1 (amino acids 117 to 489) (unknown origin) expressed in SF9 cellsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50428118(CHEMBL2331659 | US8791131, 134)
Affinity DataKi:  2nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50245854(CHEMBL504331 | N3-(2,6-dichlorophenyl)-N6-(3-fluor...)
Affinity DataKi:  2nMAssay Description:Inhibition of histidine-tagged ACK1 (amino acids 117 to 489) (unknown origin) expressed in SF9 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159347(CHEMBL3787662 | US9586965, Cpd 1)
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159358(CHEMBL3787386)
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159358(CHEMBL3787386)
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50246214(CHEMBL487897 | N3-(2,6-dimethylphenyl)-1-(3-methox...)
Affinity DataKi:  2nMAssay Description:Inhibition of histidine-tagged ACK1 (amino acids 117 to 489) (unknown origin) expressed in SF9 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50428114(CHEMBL2331662 | US8791131, 173)
Affinity DataKi:  2nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450885(CHEMBL4216749)
Affinity DataKi:  2nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 4308 total ) | Next | Last >>
Jump to: