Compile Data Set for Download or QSAR
maximum 50k data

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB (change energy unit to kcal/mol)

Found 2 hits in this display   

TargetTGF-beta receptor type-2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557763(CHEMBL4744618)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557763(CHEMBL4744618)
Affinity DataIC50:  860nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed