TargetCDK9/Cyclin-T2(Homo sapiens (Human))
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 0.626nMAssay Description:Inhibition of CDK9/Cyclin T2 (unknown origin)More data for this Ligand-Target Pair
TargetCDK9/Cyclin-T2(Homo sapiens (Human))
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 3.80nMAssay Description:Inhibition of human CDK9/cyclin-T2 using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair