Compile Data Set for Download or QSAR
maximum 50k data
Found 1 Enz. Inhib. hit(s) with Target = 'A disintegrin and metalloproteinase with thrombospondin motifs 4' and Ligand = 'BDBM50441574'
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441574(CHEMBL2437163)
Affinity DataIC50:  630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed