Found 1 Enz. Inhib. hit(s) with Target = 'A disintegrin and metalloproteinase with thrombospondin motifs 4' and Ligand = 'BDBM50441590' TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 610nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
