Compile Data Set for Download or QSAR
maximum 50k data
Found 180 of ic50 for UniProtKB: P24941
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270333(CHEMBL4080236)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270310(CHEMBL4093906)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270329(CHEMBL4073053)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270331(CHEMBL4086149)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270319(CHEMBL4093755)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270358(CHEMBL4076277)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270316(CHEMBL4104057)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270304(CHEMBL4077071)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50:  3nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270309(CHEMBL4101635)
Affinity DataIC50:  3nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270353(CHEMBL4075723)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270306(CHEMBL4077074)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270359(CHEMBL4096307)
Affinity DataIC50:  3.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270330(CHEMBL4078261)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270308(CHEMBL4074948)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270335(CHEMBL4088753)
Affinity DataIC50:  5.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270317(CHEMBL4067804)
Affinity DataIC50:  5.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  5.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270342(CHEMBL4103390)
Affinity DataIC50:  7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270354(CHEMBL4073283)
Affinity DataIC50:  7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270318(CHEMBL4071450)
Affinity DataIC50:  8.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270303(CHEMBL4061686)
Affinity DataIC50:  9.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270334(CHEMBL4099013)
Affinity DataIC50:  9.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50539903(CHEMBL4641226)
Affinity DataIC50:  11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50539902(CHEMBL4644893)
Affinity DataIC50:  11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270332(CHEMBL4077278)
Affinity DataIC50:  12nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270307(CHEMBL4092761)
Affinity DataIC50:  14nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50539906(CHEMBL4648005 | US11142507, Compound MFH-3-35-1)
Affinity DataIC50:  16nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576561(CHEMBL4876559)
Affinity DataIC50:  17nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270305(CHEMBL4103338)
Affinity DataIC50:  17nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576543(CHEMBL4870754)
Affinity DataIC50:  20nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM5931(BMS-387072 | CHEMBL296468 | N-(5-{[(5-tert-butyl-1...)
Affinity DataIC50:  21nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270356(CHEMBL4064843)
Affinity DataIC50:  24nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50563174(CHEMBL1708376)
Affinity DataIC50:  24nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270337(CHEMBL4075466)
Affinity DataIC50:  30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576545(CHEMBL4866768)
Affinity DataIC50:  31nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50515042(CHEMBL4593398)
Affinity DataIC50:  39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576556(CHEMBL4856733)
Affinity DataIC50:  39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576558(CHEMBL4873799)
Affinity DataIC50:  39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576541(CHEMBL4869193)
Affinity DataIC50:  40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50563177(CHEMBL4763182)
Affinity DataIC50:  46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576552(CHEMBL4869214)
Affinity DataIC50:  46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576559(CHEMBL4864901)
Affinity DataIC50:  49nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270360(CHEMBL4098796)
Affinity DataIC50:  57nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50576560(CHEMBL4867152)
Affinity DataIC50:  58nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50539901(CHEMBL4643057)
Affinity DataIC50:  59nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270336(CHEMBL4059849)
Affinity DataIC50:  59nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 180 total ) | Next | Last >>
Jump to: