Affinity DataIC50: <0.0500nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.0700nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.0800nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.0900nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.100nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.100nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.100nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.100nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.140nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.140nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.150nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.200nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.200nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.200nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.200nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.25nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.25nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.300nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.300nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.300nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.300nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.5nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.5nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.5nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:Inhibition of CDK2/CyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.700nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.700nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 0.900nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2/Cyclin AMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2/cyclin AMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2/cyclin AMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2/cyclin AMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2/Cyclin AMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Affinity DataIC50: 1.5nMAssay Description:Inhibition of recombinant Cdk2/cyclinAMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.60nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK2/Cyclin AMore data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK2/Cyclin A assessed as [33P]gamma-ATP incorporation into substrate after 60 mins by gamma countingMore data for this Ligand-Target Pair