Compile Data Set for Download or QSAR
Report error Found 49 Enz. Inhib. hit(s) with all data for entry = 50027503
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273759BDBM50273759(CHEMBL507591)
Affinity DataEC50:  0.00199nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273767BDBM50273767(CHEMBL503693)
Affinity DataEC50:  0.00209nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273766BDBM50273766(CHEMBL526145)
Affinity DataEC50:  0.00282nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273765BDBM50273765(CHEMBL525235)
Affinity DataEC50:  0.00288nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273771BDBM50273771(CHEMBL526164)
Affinity DataEC50:  0.00331nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273752BDBM50273752(HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR | CHEMBL503836)
Affinity DataEC50:  0.00360nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273760BDBM50273760(CHEMBL503491)
Affinity DataEC50:  0.00380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273768BDBM50273768(CHEMBL524305)
Affinity DataEC50:  0.00479nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273757BDBM50273757(CHEMBL507037)
Affinity DataEC50:  0.00759nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273758BDBM50273758(CHEMBL526516)
Affinity DataEC50:  0.0120nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273762BDBM50273762(CHEMBL525405)
Affinity DataEC50:  0.102nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273764BDBM50273764(CHEMBL500483)
Affinity DataEC50:  0.123nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273761BDBM50273761(CHEMBL502036)
Affinity DataEC50:  0.363nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273753BDBM50273753(CHEMBL524864)
Affinity DataEC50:  0.380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273753BDBM50273753(CHEMBL524864)
Affinity DataEC50:  0.380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273763BDBM50273763(CHEMBL525051)
Affinity DataEC50:  1.10nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273770BDBM50273770(CHEMBL500753)
Affinity DataEC50:  1.40nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273767BDBM50273767(CHEMBL503693)
Affinity DataIC50: 1.40nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273752BDBM50273752(HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR | CHEMBL503836)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273752BDBM50273752(HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR | CHEMBL503836)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273766BDBM50273766(CHEMBL526145)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273766BDBM50273766(CHEMBL526145)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273765BDBM50273765(CHEMBL525235)
Affinity DataIC50: 3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273765BDBM50273765(CHEMBL525235)
Affinity DataIC50: 3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273757BDBM50273757(CHEMBL507037)
Affinity DataIC50: 4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273757BDBM50273757(CHEMBL507037)
Affinity DataIC50: 4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273758BDBM50273758(CHEMBL526516)
Affinity DataIC50: 6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273758BDBM50273758(CHEMBL526516)
Affinity DataIC50: 6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273755BDBM50273755(CHEMBL525582)
Affinity DataEC50:  8.30nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273756BDBM50273756(CHEMBL525424)
Affinity DataEC50:  15nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273759BDBM50273759(CHEMBL507591)
Affinity DataIC50: 15nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273760BDBM50273760(CHEMBL503491)
Affinity DataIC50: 17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273760BDBM50273760(CHEMBL503491)
Affinity DataIC50: 17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273769BDBM50273769(CHEMBL524660)
Affinity DataEC50:  19nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273754BDBM50273754(CHEMBL526484)
Affinity DataEC50:  23nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273753BDBM50273753(CHEMBL524864)
Affinity DataIC50: 110nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273755BDBM50273755(CHEMBL525582)
Affinity DataIC50: 210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273755BDBM50273755(CHEMBL525582)
Affinity DataIC50: 210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273756BDBM50273756(CHEMBL525424)
Affinity DataIC50: 229nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273754BDBM50273754(CHEMBL526484)
Affinity DataIC50: 440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273754BDBM50273754(CHEMBL526484)
Affinity DataIC50: 440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273762BDBM50273762(CHEMBL525405)
Affinity DataIC50: 1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273762BDBM50273762(CHEMBL525405)
Affinity DataIC50: 1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273764BDBM50273764(CHEMBL500483)
Affinity DataIC50: 1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273764BDBM50273764(CHEMBL500483)
Affinity DataIC50: 1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273761BDBM50273761(CHEMBL502036)
Affinity DataIC50: 3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273761BDBM50273761(CHEMBL502036)
Affinity DataIC50: 3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273763BDBM50273763(CHEMBL525051)
Affinity DataIC50: 9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
University of Texas At Dallas

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273763BDBM50273763(CHEMBL525051)
Affinity DataIC50: 9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed