Compile Data Set for Download or QSAR
Report error Found 76 Enz. Inhib. hit(s) with all data for entry = 12587
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712445(US20250011332, Compound 21)
Affinity DataIC50: 0.700nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712438(US20250011332, Compound 14)
Affinity DataIC50: 0.800nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712364(US20250011332, Compound 1)
Affinity DataIC50: 0.900nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 1nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712433(US20250011332, Compound 8)
Affinity DataIC50: 1.13nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712441(US20250011332, Compound 17)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712440(US20250011332, Compound 16)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712427(US20250011332, Compound 2)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712443(US20250011332, Compound 19)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712439(US20250011332, Compound 15)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712434(US20250011332, Compound 9)
Affinity DataIC50: 2.81nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 3nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712445(US20250011332, Compound 21)
Affinity DataIC50: 3nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712364(US20250011332, Compound 1)
Affinity DataIC50: 4nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712445(US20250011332, Compound 21)
Affinity DataIC50: 5nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 5nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712434(US20250011332, Compound 9)
Affinity DataIC50: 5.16nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712443(US20250011332, Compound 19)
Affinity DataIC50: 6nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712438(US20250011332, Compound 14)
Affinity DataIC50: 6nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712436(US20250011332, Compound 12)
Affinity DataIC50: 6nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712440(US20250011332, Compound 16)
Affinity DataIC50: 6nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712433(US20250011332, Compound 8)
Affinity DataIC50: 6.43nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712439(US20250011332, Compound 15)
Affinity DataIC50: 9nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712430(US20250011332, Compound 5)
Affinity DataIC50: 9nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712364(US20250011332, Compound 1)
Affinity DataIC50: 10nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712437(US20250011332, Compound 13)
Affinity DataIC50: 10nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 12nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712433(US20250011332, Compound 8)
Affinity DataIC50: 13.7nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 14nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712429(US20250011332, Compound 4)
Affinity DataIC50: 20nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712427(US20250011332, Compound 2)
Affinity DataIC50: 21nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712433(US20250011332, Compound 8)
Affinity DataIC50: 22.8nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712441(US20250011332, Compound 17)
Affinity DataIC50: 28nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712435(US20250011332, Compound 10)
Affinity DataIC50: 30nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712435(US20250011332, Compound 10)
Affinity DataIC50: 33nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712430(US20250011332, Compound 5)
Affinity DataIC50: 40nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712443(US20250011332, Compound 19)
Affinity DataIC50: 42nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712440(US20250011332, Compound 16)
Affinity DataIC50: 42nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712438(US20250011332, Compound 14)
Affinity DataIC50: 51nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712440(US20250011332, Compound 16)
Affinity DataIC50: 67nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712430(US20250011332, Compound 5)
Affinity DataIC50: 78nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712429(US20250011332, Compound 4)
Affinity DataIC50: 82nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 93nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712445(US20250011332, Compound 21)
Affinity DataIC50: 99nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712437(US20250011332, Compound 13)
Affinity DataIC50: 103nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712436(US20250011332, Compound 12)
Affinity DataIC50: 122nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712427(US20250011332, Compound 2)
Affinity DataIC50: 123nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712439(US20250011332, Compound 15)
Affinity DataIC50: 124nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712434(US20250011332, Compound 9)
Affinity DataIC50: 128nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

Displayed 1 to 50 (of 76 total ) | Next | Last >>
Jump to: