Compile Data Set for Download or QSAR
Report error Found 81 Enz. Inhib. hit(s) with all data for entry = 8297
TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239968(US9403801, 33)
Affinity DataIC50: 0.400nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239977(US9403801, 48)
Affinity DataIC50: 0.400nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239976(US9403801, 46)
Affinity DataIC50: 0.5nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14B | US9403801, 14A)
Affinity DataIC50: 0.800nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239965(US9403801, 30)
Affinity DataIC50: 0.900nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239963(US9403801, 28)
Affinity DataIC50: 0.900nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239953(US9403801, 12)
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239981(US9403801, 59)
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239966(US9403801, 31)
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14B | US9403801, 14A)
Affinity DataIC50: 1nMpH: 7.0 T: 2°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239985(US9403801, 64)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239954(US9403801, 13.3B | US9403801, 13.3A)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239969(US9403801, 34)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239970(US9403801, 35)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239954(US9403801, 13.3B | US9403801, 13.3A)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239964(US9403801, 29)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239961(US9403801, 26)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239958(US9403801, 22)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14B | US9403801, 14A)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239967(US9403801, 32)
Affinity DataIC50: 3nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239968(US9403801, 33)
Affinity DataIC50: 3nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239957(US9403801, 20)
Affinity DataIC50: 3nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239974(US9403801, 42)
Affinity DataIC50: 3nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239963(US9403801, 28)
Affinity DataIC50: 4nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239984(US9403801, 62)
Affinity DataIC50: 4nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239962(US9403801, 27)
Affinity DataIC50: 4nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetAurora kinase A(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239966(US9403801, 31)
Affinity DataIC50: 4nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239963(US9403801, 28)
Affinity DataIC50: 4nMpH: 7.0 T: 2°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239982(US9403801, 60)
Affinity DataIC50: 5nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239979(US9403801, 56)
Affinity DataIC50: 5nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14B | US9403801, 14A)
Affinity DataIC50: 5nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239964(US9403801, 29)
Affinity DataIC50: 5nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239971(US9403801, 37)
Affinity DataIC50: 5nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239965(US9403801, 30)
Affinity DataIC50: 5nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239972(US9403801, 39)
Affinity DataIC50: 5nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239961(US9403801, 26)
Affinity DataIC50: 6nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239958(US9403801, 22)
Affinity DataIC50: 6nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239960(US9403801, 25)
Affinity DataIC50: 6nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239986(US9403801, 66)
Affinity DataIC50: 7nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239951(US9403801, 10)
Affinity DataIC50: 7nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239957(US9403801, 20)
Affinity DataIC50: 7nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239953(US9403801, 12)
Affinity DataIC50: 7nMpH: 7.0 T: 2°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239956(US9403801, 18)
Affinity DataIC50: 7nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239970(US9403801, 35)
Affinity DataIC50: 8nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239950(US9403801, 8)
Affinity DataIC50: 11nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239971(US9403801, 37)
Affinity DataIC50: 11nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239974(US9403801, 42)
Affinity DataIC50: 12nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239966(US9403801, 31)
Affinity DataIC50: 12nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239954(US9403801, 13.3B | US9403801, 13.3A)
Affinity DataIC50: 14nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239978(US9403801, 50)
Affinity DataIC50: 14nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

Displayed 1 to 50 (of 81 total ) | Next | Last >>
Jump to: