Cell Reactant:
Streptavidin
Syringe Reactant:
BDBM12
Meas. Tech.:
ITC
Entry Date.:
12/19/00
pH:
7±n/a
Temperature:
310.15±n/a (K)
ΔH° :
-123.0096±n/a (kJ/mole)
ΔHobs :
-123.0096±n/a (kJ/mole)
Citation
 Klumb, LAChu, VStayton, PS Energetic roles of hydrogen bonds at the ureido oxygen binding pocket in the streptavidin-biotin complex. Biochemistry 37:7657-63 (1998) [PubMed]  Article
Cell React
Source:
Protein was expressed in a T7 expression system (pET-21a, Novagen Inc.,Madison,WI) as insoluble inclusion bodies.
Prep. Method:
Refolded protein was purified by affinity chromatography with iminobiotin-agarose.
Name:
Streptavidin
Synonyms:
n/a
Type:
Protein
Mol. Mass.:
18835.54
Organism:
Streptomyces avidinii
Description:
P22629
Residue:
183
Sequence:
MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
  
Syringe React
Name:
BDBM12
Synonyms:
5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazolidin-4-yl]pentanoic acid | Biotin | cid_171548 | cid_253
Type:
Enzyme co-factor
Emp. Form.:
C10H16N2O3S
Mol. Mass.:
244.311
SMILES:
[H][C@]12CS[C@@H](CCCCC(O)=O)[C@@]1([H])NC(=O)N2 |r|
Structure:
Search PDB for entries with ligand similarity: