Cell Reactant:
HyHEL-10 Mutant (ETKF)
Syringe Reactant:
Lysozyme (hen egg)
Meas. Tech.:
ITC
Entry Date.:
12/20/00
ΔG°:
-41.2±n/a (kJ/mole)
pH:
7.2±n/a
Temperature:
308±n/a (K)
ΔH° :
-76.9±n/a (kJ/mole)
ΔHobs :
-76.9±n/a (kJ/mole)
ΔCp :
-2.59±n/a (kJ/mole)
ΔS° :
-0.116±n/a (kJ/mole-K)
Citation
 Nishimiya, YTsumoto, KShiroishi, MYutani, KKumagai, I Thermodynamic consequences of grafting enhanced affinity toward the mutated antigen onto an antibody. The case of anti-lysozyme antibody, HyHEL-10. J Biol Chem 275:12813-20 (2000) [PubMed]  Article
Cell React
Source:
E. coli strain BL21 (DE3)
Prep. Method:
TEL-Sepharose column, and then Superdex 75 Prep Grade column
Name:
Lysozyme (hen egg)
Synonyms:
D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:
Enzyme
Mol. Mass.:
16805.63
Organism:
Mus musculus (mouse)
Description:
P17897
Residue:
148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV
  
Syringe React
Source:
Seikagaku-kogyo Inc. (Tokyo, Japan)
Name:
Lysozyme (hen egg)
Synonyms:
D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:
Enzyme
Mol. Mass.:
16805.63
Organism:
Mus musculus (mouse)
Description:
P17897
Residue:
148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV