Cell Reactant:
HyHEL-10 Mutant (AEAF)
Syringe Reactant:
Lysozyme (turkey egg)
Meas. Tech.:
ITC
Entry Date.:
12/20/00
ΔG°:
-49.8±n/a (kJ/mole)
pH:
7.2±n/a
Temperature:
308±n/a (K)
ΔH° :
-94.9±n/a (kJ/mole)
ΔHobs :
-94.9±n/a (kJ/mole)
ΔCp :
-2.4±n/a (kJ/mole)
ΔS° :
-0.146±n/a (kJ/mole-K)
Citation
 Nishimiya, YTsumoto, KShiroishi, MYutani, KKumagai, I Thermodynamic consequences of grafting enhanced affinity toward the mutated antigen onto an antibody. The case of anti-lysozyme antibody, HyHEL-10. J Biol Chem 275:12813-20 (2000) [PubMed]  Article
Cell React
Source:
E. coli strain BL21 (DE3)
Prep. Method:
TEL-Sepharose column, and then Superdex 75 Prep Grade column
Name:
HyHEL-10 Mutant (AEAF)
Synonyms:
n/a
Type:
Antibody
Mol. Mass.:
12701.77
Organism:
Mus musculus (mouse)
Description:
HyHEL-10 mutations(Y53A,S54E,S56A,Y58F) in VH
Residue:
114
Sequence:
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSAEGATFYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
  
Syringe React
Source:
Sigma
Name:
Lysozyme (turkey egg)
Synonyms:
turkey egg lysozyme (TEL)
Type:
Enzyme
Mol. Mass.:
16145.52
Organism:
Meleagris gallopavo
Description:
P00703
Residue:
147
Sequence:
MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRGCRL