Target
Melanin-concentrating hormone receptor 1
Ligand
BDBM50381340
Substrate
n/a
Meas. Tech.
ChEMBL_814483 (CHEMBL2021002)
IC50
782±n/a nM
Citation
 Sasmal, SBalaji, GKanna Reddy, HRBalasubrahmanyam, DSrinivas, GKyasa, SSasmal, PKKhanna, ITalwar, RSuresh, JJadhav, VPMuzeeb, SShashikumar, DHarinder Reddy, KSebastian, VJFrimurer, TMRist, Elster, LHögberg, T Design and optimization of quinazoline derivatives as melanin concentrating hormone receptor 1 (MCHR1) antagonists. Bioorg Med Chem Lett 22:3157-62 (2012) [PubMed]  Article 
Target
Name:
Melanin-concentrating hormone receptor 1
Synonyms:
G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | MCHR1 | MCHR1_HUMAN | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | SLC1 | Somatostatin receptor-like protein
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
45976.27
Organism:
Homo sapiens (Human)
Description:
Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:
422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
  
Inhibitor
Name:
BDBM50381340
Synonyms:
CHEMBL2016700
Type:
Small organic molecule
Emp. Form.:
C26H32ClN5O2
Mol. Mass.:
482.018
SMILES:
Cc1nc(nc2ccc(NC(=O)COc3ccc(Cl)cc3)cc12)N1CCN(CC(C)(C)C)CC1
Structure:
Search PDB for entries with ligand similarity: