| Assay Method Information | |
| | EGFR, MAPK and PDK Inhibitory Acitivity Assay |
| Description: | EGFR was incubated with 8 mM MOPS (pH 7.0), 0.2 mM EDTA, 10 mM MnCl2, 0.1 mg/mL poly(Glu, Tyr) 4:1. MAPK1 was incubated with 25 mM Tris (pH 7.5), 0.02 mM EGTA, 250 µM substrate peptide (MAPK1-peptide), whereas PDK1 was incubated with 50 mM Tris (pH 7.5), 100 µM [protein fragment, 39 aa] (PDKtide). The incubation was followed by the addition of 10 mM magnesium acetate and gamma-P33-ATP to each kinase. The kinase reactions were initiated with the addition of Mg:ATP mixture and stopped after 40 min of incubation with the addition of 3% phosphoric acid solution. |
| Affinity data for this assay | |
|---|---|
| If you find an error in this entry please send us an E-mail | |