Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT3A Serotonin Receptor
LigandBDBM16173
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2650
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
5-HT3A Serotonin Receptor
Name:5-HT3A Serotonin Receptor
Synonyms:5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor
Type:n/a
Mol. Mass.:56056.00
Organism:Mus musculus (house mouse)
Description:5HT3A
Residue:487
Sequence:
MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16173
NameBDBM16173
Synonyms:3,5-diamino-6-chloro-N-(diaminomethylene)pyrazinamide;hydrochloride | 3,5-diamino-N-carbamimidoyl-6-chloropyrazine-2-carboxamide | Amiloride | Amipramidin | CHEMBL945
TypeSmall organic molecule
Emp. Form.C6H8ClN7O
Mol. Mass.229.627
SMILESNC(=N)NC(=O)c1nc(Cl)c(N)nc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a