Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50002515
Substrate/Competitorn/a
Ki 4500±n/a nM
CommentsPDSP_2192
Citation Lin, CWShiosaki, KMiller, TRWitte, DGBianchi, BRWolfram, CAKopecka, HCraig, RWagenaar, FNadzan, AM Characterization of two novel cholecystokinin tetrapeptide (30-33) analogues, A-71623 and A-70874, that exhibit high potency and selectivity for cholecystokinin-A receptors. Mol Pharmacol39:346-51 (1991) [PubMed]
More Info.:Get all data from this article
 
CCKBR
Name:CCKBR
Synonyms:Cholecystokinin A
Type:Enzyme Catalytic Domain
Mol. Mass.:48683.10
Organism:GUINEA PIG
Description:Cholecystokinin A CCKBR GUINEA PIG::H0VZC5
Residue:450
Sequence:
MELLKLNRSLQGPGPGPGAPLCRPAGPLLNSSGAGNVSCETPRIRGAGTRVKSMAILFNV
TSLLSCWNKYRIIKVLGLSRRLRTVTKAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFG
TVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSG
LLMVPYPVYTAVQPVGPRVLQCVHRWPNARVRQTWSVLLLLLLFFVPGVVMAVAYGLISR
ELYLGLRFDGDADSESQSRVRGPGGLSGSAPGPAHQNGRCRPESGLSGEDSDGCYVQLPR
SRPALELSALAASTPAPGPGPRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRA
FDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARP
RPLPEEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002515
NameBDBM50002515
Synonyms:(A-71623)3-[2-[2-tert-Butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-6-(3-o-tolyl-ureido)-hexanoylamino]-N-(1-carbamoyl-2-phenyl-ethyl)-N-methyl-succinamic acid | A-71623
TypeSmall organic molecule
Emp. Form.C44H56N8O9
Mol. Mass.840.9636
SMILESCN(C(Cc1ccccc1)C(N)=O)C(=O)C(CC(O)=O)NC(=O)[C@H](CCCCNC(=O)Nc1ccccc1C)NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a