Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50001464
Substrate/Competitorn/a
Meas. Tech.ChEBML_135591
IC50 43±n/a nM
Citation Schiller, PWWeltrowska, GNguyen, TMWilkes, BCChung, NNLemieux, C Conformationally restricted deltorphin analogues. J Med Chem35:3956-61 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001464
NameBDBM50001464
Synonyms:3-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-propionylamino}-3-phenyl-propionylamino)-N-{1-[1-(carbamoylmethyl-carbamoyl)-2-methyl-propylcarbamoyl]-2-methyl-propyl}-succinamic acid | CHEMBL337898 | Deltorphin I
TypeSmall organic molecule
Emp. Form.C37H52N8O10
Mol. Mass.768.8564
SMILESCC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](Cc1ccccc1)NC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a