Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50004186
Substrate/Competitorn/a
Meas. Tech.ChEBML_63655
pH7.5±n/a
IC50>5000±n/a nM
Commentsextracted
Citation Skiles, JWMiao, CSorcek, RJacober, SMui, PWChow, GWeldon, SMPossanza, GSkoog, MKeirns, J Inhibition of human leukocyte elastase by N-substituted peptides containing alpha,alpha-difluorostatone residues at P1. J Med Chem35:4795-808 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004186
NameBDBM50004186
Synonyms:4-{2-[(2-Benzyloxycarbonylamino-3-methyl-butyryl)-indan-2-yl-amino]-acetylamino}-2,2-difluoro-5-methyl-3-oxo-hexanoic acid | CHEMBL144895
TypeSmall organic molecule
Emp. Form.C31H37F2N3O7
Mol. Mass.601.6382
SMILESCC(C)C(NC(=O)OCc1ccccc1)C(=O)N(CC(=O)NC(C(C)C)C(=O)C(F)(F)C(O)=O)C1Cc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a