Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransmembrane domain-containing protein TMIGD3
LigandBDBM50259304
Substrate/Competitorn/a
Meas. Tech.ChEBML_1691289
IC50 187±n/a nM
Citation Poli, DFalsini, MVarano, FBetti, MVarani, KVincenzi, FPugliese, AMPedata, FDal Ben, DThomas, APalchetti, IBettazzi, FCatarzi, DColotta, V Imidazo[1,2-a]pyrazin-8-amine core for the design of new adenosine receptor antagonists: Structural exploration to target the A Eur J Med Chem125:611-628 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Transmembrane domain-containing protein TMIGD3
Name:Transmembrane domain-containing protein TMIGD3
Synonyms:TMIGD3 | Transmembrane domain-containing protein TMIGD3
Type:PROTEIN
Mol. Mass.:30335.79
Organism:Homo sapiens (Human)
Description:ChEMBL_114868
Residue:266
Sequence:
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259304
NameBDBM50259304
Synonyms:CHEMBL4070079
TypeSmall organic molecule
Emp. Form.C26H18N4O2
Mol. Mass.418.4467
SMILESO=C(N(C(=O)c1ccccc1)c1nccn2cc(nc12)-c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a