Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl Cholesterol Acyltransferase 1 (ACAT-1)
LigandBDBM50051901
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28659
IC50 40±n/a nM
Citation Astles, PCAshton, MJBridge, AWHarris, NVHart, TWParrott, DPPorter, BRiddell, DSmith, CWilliams, RJ Acyl-CoA:Cholesterol O-acyltransferase (ACAT) inhibitors. 2. 2-(1,3-Dioxan-2-yl)-4,5-diphenyl-1H-imidazoles as potent inhibitors of ACAT. J Med Chem39:1423-32 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl Cholesterol Acyltransferase 1 (ACAT-1)
Name:Acyl coenzyme A:cholesterol acyltransferase 1
Synonyms:Acetyl-CoA acetyltransferase, mitochondrial | Acyl coenzyme A:cholesterol acyltransferase 1 | Acyl-CoA: cholesterol acyltransferase (ACAT) | Acyl-coenzyme A:cholesterol acyltransferase 1 (ACAT1) | Cholesterol acyltransferase 1
Type:Multi-pass membrane protein may form homo- or heterodimers.
Mol. Mass.:64751.94
Organism:Homo sapiens (Human)
Description:n/a
Residue:550
Sequence:
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE
LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK
IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK
FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT
YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR
VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW
NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM
FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR
PRSWTCRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051901
NameBDBM50051901
Synonyms:1-[5-(4,5-Diphenyl-1H-imidazol-2-ylsulfanyl)-pentyl]-3,5-dimethyl-1H-pyrazole | CHEMBL33780
TypeSmall organic molecule
Emp. Form.C25H28N4S
Mol. Mass.416.582
SMILESCc1cc(C)n(CCCCCSc2nc(c([nH]2)-c2ccccc2)-c2ccccc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a