Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50054128
Substrate/Competitorn/a
Meas. Tech.ChEMBL_39458
IC50 4.9±n/a nM
Citation Anzini, MCappelli, AVomero, SGiorgi, GLanger, TBruni, GRomeo, MRBasile, AS Molecular basis of peripheral vs central benzodiazepine receptor selectivity in a new class of peripheral benzodiazepine receptor ligands related to alpidem. J Med Chem39:4275-84 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054128
NameBDBM50054128
Synonyms:2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N,N-dipropyl-acetamide | CHEMBL134590
TypeSmall organic molecule
Emp. Form.C25H24ClN3O2
Mol. Mass.433.93
SMILESCCCN(CCC)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a