Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 7
LigandBDBM50277665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497592
IC50 730±n/a nM
Citation Akama, TBaker, SJZhang, YKHernandez, VZhou, HSanders, VFreund, YKimura, RMaples, KRPlattner, JJ Discovery and structure-activity study of a novel benzoxaborole anti-inflammatory agent (AN2728) for the potential topical treatment of psoriasis and atopic dermatitis. Bioorg Med Chem Lett19:2129-32 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 7
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 7 (PDE7) | Phosphodiesterase 7A | Phosphodiesterase 7A (PDE7A1)
Type:Enzyme
Mol. Mass.:55514.96
Organism:Homo sapiens (Human)
Description:Q13946
Residue:482
Sequence:
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277665
NameBDBM50277665
Synonyms:4-(1-hydroxy-1,3-dihydrobenzo[c][1,2]oxaborol-5-yloxy)benzonitrile | 5-(4-cyanophenoxy)-2,3-dihydro-1-hydroxy-2,1-benzoxaborole | AN-2728 | CHEMBL484785 | Crisaborole | Eucrisa
TypeSmall organic molecule
Emp. Form.C14H10BNO3
Mol. Mass.251.045
SMILESOB1OCc2cc(Oc3ccc(cc3)C#N)ccc12
Structure
n/a