BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50024317
Substrate/Competitorn/a
Meas. Tech.ChEBML_48260
IC50 4250±n/a nM
Citation Horwell, DCNichols, PDRoberts, E Methionine replacements in biologically active peptides Bioorg Med Chem Lett4:2263-2266 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin peripheral | Cholecystokinin receptor type A
Type:Enzyme Catalytic Domain
Mol. Mass.:49676.37
Organism:RAT
Description:Cholecystokinin central 0 RAT::P30551
Residue:444
Sequence:
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI
LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK
DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT
WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM
VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL
SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE
KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE
DGRTIRALLSRYSYSHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024317
NameBDBM50024317
Synonyms:3-{2-[2-Amino-3-(1H-indol-3-yl)-propionylamino]-4-methylsulfanyl-butyrylamino}-N-(1-carbamoyl-2-phenyl-ethyl)-succinamic acid | CHEMBL120632 | TETRAGASTRIN | Tetragastrin
TypeSmall organic molecule
Emp. Form.C29H36N6O6S
Mol. Mass.596.698
SMILESCSCC[C@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a