Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM21220
Substrate/Competitorn/a
Ki 27±n/a nM
CommentsPDSP_1302
Citation Hill, RJOleynek, JJHoth, CFKiron, MAWeng, WWester, RTTracey, WRKnight, DRBuchholz, RAKennedy, SP Cloning, expression and pharmacological characterization of rabbit adenosine A1 and A3 receptors. J Pharmacol Exp Ther280:122-8 (1997) [PubMed]
More Info.:Get all data from this article
 
Adenosine receptor A3
Name:Adenosine receptor A3
Synonyms:ADENOSINE A3
Type:Protein
Mol. Mass.:36319.35
Organism:Oryctolagus cuniculus (rabbit)
Description:O02667
Residue:319
Sequence:
MPDNSTTLFLAIRASYIVFEIVIGVCAVVGNVLVIWVIKLNPSLKTTTFYFIFSLALADI
AVGFLVMPLAIVISLGITIGFYSCLVMSCLLLVFTHASIMSLLAIAVDRYLRVKLTVRYR
RVTTQRRIWLALGLCWVVSLLVGFTPMFGWNMKPTLESARNYSDFQCKFDSVIPMEYMVF
FSFFTWILIPLLLMCALYVYIFYIIRNKLVQSFSSFKETGAFYRREFKTAKSLFLVLALF
AGCWLPLSIINCVTYFKCKVPDVVLLVGILLSHANSMMNPIVYACKIQKFKETYLLIFKA
RVTCQPSDSLDPSSEQNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21220
NameBDBM21220
Synonyms:(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-N-ethyl-3,4-dihydroxyoxolane-2-carboxamide | Adenosine analog, 3 | Adenosine, N6-Ethyl-carboxamido | Adenosine-5-(N-ethylcarboxamide) | CHEMBL464859 | N-Ethylcarboxamidoadenosine | NECA
TypeAntineoplastic Agent
Emp. Form.C12H16N6O4
Mol. Mass.308.2932
SMILESCCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a