BDBM50563891 CHEMBL4793380
SMILES CC(C)(C)c1cc(NC(=O)Nc2ccc(Nc3ncnc4NCCCOc34)cc2)no1
InChI Key InChIKey=WPXVVAWAHQHJPF-UHFFFAOYSA-N
Data 49 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 49 hits for monomerid = 50563891
TargetVascular endothelial growth factor receptor 3(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant human FLT4 (800 to end residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gamma-33ATP] by s...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 1(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 8nMAssay Description:Inhibition of recombinant human FLT1 (783 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
TargetMacrophage colony-stimulating factor 1 receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 9nMAssay Description:Inhibition of recombinant human FMS (538 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sci...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 9nMAssay Description:Inhibition of recombinant human RET V804L mutant using KKKVSRSGLYRSP as substrate incubated for 15 mins followed by Mg/ATP addition and measured afte...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant human RET using KKKSPGEYVNIEFG as substrate incubated for 15 mins followed by Mg/ATP addition and measured after 40 mins by...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant human FLT3 (564 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of recombinant human RET V804M mutant using KKKVSRSGLYRSP as substrate incubated for 15 mins followed by Mg/ATP addition and measured afte...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 20(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 19nMAssay Description:Inhibition of recombinant full-length human ZAK using MBP as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation counting b...More data for this Ligand-Target Pair
TargetNT-3 growth factor receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of recombinant human TRKC (510 to end residues) using GEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by sc...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 11(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 50nMAssay Description:Inhibition of recombinant human full length SAPK2b using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scin...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase FRK(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 51nMAssay Description:Inhibition of recombinant human PTK5 (218 to end residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by s...More data for this Ligand-Target Pair
TargetDiscoidin domain-containing receptor 2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 55nMAssay Description:Inhibition of recombinant human DDR2 (467 to end residues) using KKSRGDYMTMQIG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sci...More data for this Ligand-Target Pair
TargetBDNF/NT-3 growth factors receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 68nMAssay Description:Inhibition of recombinant human TRKB (455 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma33P]ATP b...More data for this Ligand-Target Pair
TargetHigh affinity nerve growth factor receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 71nMAssay Description:Inhibition of recombinant human TRKA (440 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sc...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase HCK(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 87nMAssay Description:Inhibition of human HCK (230 to 497 residues) using KVEKIGEGTYGVVYK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 104nMAssay Description:Inhibition of recombinant human EphA2 (596 to 900 residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase Lyn(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 122nMAssay Description:Inhibition of recombinant human Lyn using poly(Glu, Tyr) 4:1 as substrate after 40 mins in presence of [gamma-33ATP] by scintillation counting based ...More data for this Ligand-Target Pair
TargetHomeodomain-interacting protein kinase 4(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 127nMAssay Description:Inhibition of human HIPK4 using RRRFRPASPLRGPPK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetMAP kinase-interacting serine/threonine-protein kinase 2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 136nMAssay Description:Inhibition of recombinant human MNK2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33ATP by scintillation count...More data for this Ligand-Target Pair
TargetInterleukin-1 receptor-associated kinase 1(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 179nMAssay Description:Inhibition of human IRAK1 (194 to end residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 7(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 12(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human full length SAPK3 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 13(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 214nMAssay Description:Inhibition of recombinant human full length SAPK4 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
TargetMast/stem cell growth factor receptor Kit(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 218nMAssay Description:Inhibition of recombinant human C-Kit using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillation count...More data for this Ligand-Target Pair
TargetTRAF2 and NCK-interacting protein kinase(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 221nMAssay Description:Inhibition of human TNIK (1 to 367 residues) using RLGRDKYKTLRQIRQ as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation c...More data for this Ligand-Target Pair
TargetRAF proto-oncogene serine/threonine-protein kinase(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 232nMAssay Description:Inhibition of recombinant human C-Raf (306 to end residues) poly(Glu, Tyr) 4:1 as substrate incubated 40 mins in presence of [gamma-33ATP] by scintil...More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor alpha(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 262nMAssay Description:Inhibition of human PDGFRalpha (550 to end residues) using poly(Glu, Tyr) 4:1 as substrate measured after 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase ITK/TSK(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 338nMAssay Description:Inhibition of human ITK (352 to 617 residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetEphrin type-B receptor 1(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 388nMAssay Description:Inhibition of recombinant human EphB1 (564 to end residues) using KVEKIGEGTYGVVYK as substrate incubated for 40 mins in presence of [gamma-33ATP] by ...More data for this Ligand-Target Pair
TargetAngiopoietin-1 receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 408nMAssay Description:Inhibition of recombinant human TIE2 (771 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma33P]ATP b...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 7(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 484nMAssay Description:Inhibition of recombinant human TAK1 (1 to 303 residues) using casein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillatio...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase WNK3(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 494nMAssay Description:Inhibition of recombinant human WNK3 (1 to 434 residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP b...More data for this Ligand-Target Pair
TargetCasein kinase I isoform delta(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 509nMAssay Description:Inhibition of recombinant human CK1delta (1 to 294 residues) using KRRRALS(p)VASLPGL as substrate incubated for 40 mins in presence of [gamma-33ATP] ...More data for this Ligand-Target Pair
TargetEphrin type-A receptor 3(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 552nMAssay Description:Inhibition of recombinant human EphA3 (578 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor beta(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 686nMAssay Description:Inhibition of human PDGFRbeta (557 to end residues) using poly(Glu, Tyr) 4:1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scin...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 708nMAssay Description:Inhibition of recombinant human Axl (473 to end residues) using KKSRGDYMTMQIG as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 5(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 711nMAssay Description:Inhibition of recombinant human MAP4K5 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33ATP by scintillation cou...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 833nMAssay Description:Inhibition of recombinant full length human CDK9/cyclinT1 using KTFCGTPEYLAPE as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...More data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 1(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 868nMAssay Description:Inhibition of recombinant human FGFR1 (456 to 765 residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by s...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 892nMAssay Description:Inhibition of human KDR (790 to end residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase TAO2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 903nMAssay Description:Inhibition of recombinant human TAO2 (1 to 320 residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP b...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase B-raf(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 957nMAssay Description:Inhibition of recombinant full length human B-Raf (416 to end residues) using myelin basic protein substrate incubated for 40 mins in presence of [ga...More data for this Ligand-Target Pair
TargetEphrin type-B receptor 2(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.09E+3nMAssay Description:Inhibition of recombinant human EphB2 (560 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.11E+3nMAssay Description:Inhibition of recombinant full length human CDK4/CyclinD3 using Rb fragment as substrate incubated for 40 mins in presence of [gamma-33ATP] by scinti...More data for this Ligand-Target Pair
TargetMacrophage-stimulating protein receptor(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.26E+3nMAssay Description:Inhibition of recombinant human Ron (983 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by s...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase Mer(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.49E+3nMAssay Description:Inhibition of recombinant human MER (557 to 882 residues) using KKLNRTLSFAEPG as substrate incubated for 40 mins in presence of [gamma-33ATP by scint...More data for this Ligand-Target Pair
TargetAurora kinase B(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.63E+3nMAssay Description:Inhibition of recombinant full length human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillati...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek9(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of recombinant human NEK9 (1 to 324 residues) using myelin basic protein as substrate measured after 40 mins in presence of [gamma33P]ATP ...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase Blk(Human)
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 1.91E+3nMAssay Description:Inhibition of recombinant full length human BLK using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintilla...More data for this Ligand-Target Pair
