Found 1 Enz. Inhib. hit(s) with Target = 'Ephrin type-A receptor 7' and Ligand = 'BDBM50563891' TargetEphrin type-A receptor 7(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
