BDBM194646 US9206139, 5

SMILES CC(C)(Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1

InChI Key InChIKey=FJEJHTFPLBTMLO-SFHVURJKSA-N

Data  20 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 20 hits for monomerid = 194646   

LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  7nMpH: 7.5 T: 25°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetCollagenase 3(Human)
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4.80E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  64nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetInterstitial collagenase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4.55E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

Target72 kDa type IV collagenase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4.65E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetStromelysin-1(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  1.32E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetNeutrophil collagenase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  54nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetMatrix metalloproteinase-9(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  7.59E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetMacrophage metalloelastase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  71nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetCollagenase 3(Human)
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4.81E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetMatrix metalloproteinase-14(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  1.49E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetMatrilysin(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50: >1.00E+5nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  7nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMatrix metalloproteinase-14(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  1.50E+4nMAssay Description:In vitro inhibitory activity against S-adenosyl-L-methionine decarboxylase using liver from rat in absence of putrescineMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  64nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target72 kDa type IV collagenase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4.70E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetStromelysin-1(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  1.30E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMacrophage metalloelastase(Human)
Eli Lilly

US Patent
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  71nMAssay Description:Competitive inhibition against rat cytoplasmic Thymidine kinaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM194646(US9206139, 5)
Affinity DataIC50:  4nMpH: 7.5 T: 25°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent