BDBM50557757 CHEMBL4792464

SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)[C@H]1COC(C)(C)C1

InChI Key InChIKey=PETJVBHONPBYQW-CYBMUJFWSA-N

Data  2 IC50

PDB links: 1 PDB ID matches this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 2 hits for monomerid = 50557757   

TargetActivin receptor type-2A(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557757(CHEMBL4792464)
Affinity DataIC50:  4.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557757(CHEMBL4792464)
Affinity DataIC50: <3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB