BDBM50557766 CHEMBL4751832

SMILES Cn1cc(cn1)-c1nc2c(cnn2cc1OCCC(C)(C)O)-c1ccnc(OC2CC2)c1

InChI Key InChIKey=KPXQGLYUMYUHHN-UHFFFAOYSA-N

Data  9 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 9 hits for monomerid = 50557766   

TargetTGF-beta receptor type-2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50:  0.830nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50:  3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50:  2.28E+4nMAssay Description:Inhibition of human ERG expressed in HEK293 cells measured by whole cell patch clamp methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 3A4(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP3A4 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 2C9(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50:  7.80E+3nMAssay Description:Inhibition of CYP2C9 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 2D6(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2D6 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 1A2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP1A2 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 2C19(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2C19 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytochrome P450 2C8(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557766(CHEMBL4751832)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2C8 in human liver microsomesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed