BDBM50570315 CHEMBL4845688

SMILES CNc1nc(C)c(s1)-c1nc(Nc2cc(C)cc(c2)N2CCCCCC2)ncc1C#N

InChI Key InChIKey=MTJJCZRPNOKRPO-UHFFFAOYSA-N

Data  2 KI

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 2 hits for monomerid = 50570315   

TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570315(CHEMBL4845688)
Affinity DataKi:  25nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570315(CHEMBL4845688)
Affinity DataKi:  52nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed