Affinity DataKi: <0.100nMAssay Description:Binding affinity to EZH2 (unknown origin)More data for this Ligand-Target Pair
TargetMetabotropic glutamate receptor 5(Rattus norvegicus (Rat))
Merck Research Laboratories
Curated by PDSP Ki Database
Merck Research Laboratories
Curated by PDSP Ki Database
Affinity DataKi: 0.490nMAssay Description:In vitro binding affinity against rat histamine H3 receptorMore data for this Ligand-Target Pair
Affinity DataKi: 0.490nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:In vitro antagonist potency at Histamine H3 receptor measured as K+-evoked [3H]-histamine release from synaptosomes of rat cerebral cortex.More data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.740nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 0.740nMAssay Description:Antagonistic activity for Histamine H3 receptor binding in guinea pigMore data for this Ligand-Target Pair
Affinity DataKi: 0.794nMAssay Description:Antagonistic activity for Histamine H3 receptor on electrically evoked guinea-pig ileum contractionMore data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 0.890nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of wild type EZH2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 1.20nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.58nMAssay Description:Antagonistic activity for Histamine H3 receptor on electrically evoked guinea-pig ileum contractionMore data for this Ligand-Target Pair
Affinity DataKi: 1.60nMAssay Description:Antagonistic activity for Histamine H3 receptor binding in guinea pigMore data for this Ligand-Target Pair
Affinity DataKi: 1.90nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of wild type EZH2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 2.20nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 2.30nMAssay Description:In vitro antagonist potency at Histamine H3 receptor measured as K+-evoked [3H]-histamine release from synaptosomes of rat cerebral cortex.More data for this Ligand-Target Pair
Affinity DataKi: 2.30nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Binding affinity to human NK2 receptorMore data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Binding affinity to human NK3 receptorMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.60nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
TargetNeuronal acetylcholine receptor subunit alpha-7(Rattus norvegicus (Rat))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 2.90nMAssay Description:Displacement of [3H]MLA from alpha-7 nACh receptor in rat brainMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Inhibition of wild type EZH2 Y641N mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 3.98nMAssay Description:Antagonistic activity for Histamine H3 receptor on electrically evoked guinea-pig ileum contractionMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:In vitro binding affinity against rat histamine H3 receptorMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:In vitro antagonist potency at Histamine H3 receptor measured as K+-evoked [3H]-histamine release from synaptosomes of rat cerebral cortex.More data for this Ligand-Target Pair
Affinity DataKi: 4.80nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 4.80nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Antagonistic activity for Histamine H3 receptor binding in guinea pigMore data for this Ligand-Target Pair
Affinity DataKi: 5.01nMAssay Description:Antagonistic activity for Histamine H3 receptor on electrically evoked guinea-pig ileum contractionMore data for this Ligand-Target Pair
Affinity DataKi: 5.90nMAssay Description:Effect on histamine H3 receptors in vitro, on synaptosomes of rat cerebral cortex for the release of [3H]histamineMore data for this Ligand-Target Pair
TargetNeuronal acetylcholine receptor subunit alpha-7(Rattus norvegicus (Rat))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 6.20nMAssay Description:Displacement of [3H]MLA from alpha-7 nACh receptor in rat brainMore data for this Ligand-Target Pair
Affinity DataKi: 6.31nMAssay Description:Antagonistic activity for Histamine H3 receptor on electrically evoked guinea-pig ileum contractionMore data for this Ligand-Target Pair
TargetNitric oxide synthase, brain(Rattus norvegicus (rat))
University Of California
Curated by ChEMBL
University Of California
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibition of rat nNOS expressed in Escherichia coli using L-arginine as substrate assessed as formation of nitric oxide by hemoglobin capture assayMore data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:Displacement of [3H]MLA from alpha-7 nACh receptor in human IMR32 cellsMore data for this Ligand-Target Pair