Compile Data Set for Download or QSAR
maximum 50k data
Found 172 with Last Name = 'dumont' and Initial = 'j'
TargetPeptidyl-prolyl cis-trans isomerase A(Homo sapiens (Human))
Southern Research Institute

Curated by ChEMBL
LigandPNGBDBM50339127((3S,6S,9S,12R,15S,18S,21S,24S,27R,30S,33S)-25,30-d...)
Affinity DataKi:  0.340nMAssay Description:Inhibition of human recombinant cyclophilin-associted cis-trans propyl isomerase activityMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPeptidyl-prolyl cis-trans isomerase A(Homo sapiens (Human))
Southern Research Institute

Curated by ChEMBL
LigandPNGBDBM50339126((3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-24-sec-buty...)
Affinity DataKi:  2.11nMAssay Description:Inhibition of human recombinant cyclophilin-associted cis-trans propyl isomerase activityMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPeptidyl-prolyl cis-trans isomerase A(Homo sapiens (Human))
Southern Research Institute

Curated by ChEMBL
LigandPNGBDBM50022815((3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33...)
Affinity DataKi:  9.79nMAssay Description:Inhibition of human recombinant cyclophilin-associted cis-trans propyl isomerase activityMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPeroxisomal N(1)-acetyl-spermine/spermidine oxidase(Mus musculus)
Merrell Dow Research Institute

Curated by ChEMBL
LigandPNGBDBM50015358(CHEMBL417844 | N,N'-BIS(2,3-BUTADIENYL)-1,4-BUTANE...)
Affinity DataKi:  1.70E+3nMAssay Description:Tested for in vitro binding affinity against polyamine oxidase after intraperitoneal administration in the rat liverMore data for this Ligand-Target Pair
TargetPeroxisomal N(1)-acetyl-spermine/spermidine oxidase(Mus musculus)
Merrell Dow Research Institute

Curated by ChEMBL
LigandPNGBDBM50368113(CHEMBL1202500)
Affinity DataKi:  2.50E+3nMAssay Description:Tested for in vitro binding affinity against polyamine oxidase after intraperitoneal administration in the rat liverMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPeroxisomal N(1)-acetyl-spermine/spermidine oxidase(Mus musculus)
Merrell Dow Research Institute

Curated by ChEMBL
LigandPNGBDBM50015357(Buta-2,3-dienyl-[3-(3-buta-2,3-dienylamino-propyla...)
Affinity DataKi:  3.00E+3nMAssay Description:Tested for in vitro binding affinity against polyamine oxidase after intraperitoneal administration in the rat liverMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeprilysin(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM21641(2-(2-benzyl-3-sulfanylpropanamido)acetic acid | CH...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human NEP-mediated amyloid beta hydrolysisMore data for this Ligand-Target Pair
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079775(17-Ethyl-1,14-dihydroxy-12-{2-[4-(2-hydroxy-2-naph...)
Affinity DataIC50:  2.80nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079784(12-{2-[4-(2-Benzo[b]thiophen-2-yl-2-hydroxy-ethoxy...)
Affinity DataIC50:  4nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079783(12-{2-[4-(2-Benzo[b]thiophen-2-yl-2-hydroxy-ethoxy...)
Affinity DataIC50:  4.20nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079776(17-Ethyl-1,14-dihydroxy-12-(2-{4-[2-hydroxy-2-(3-t...)
Affinity DataIC50:  4.90nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079782(17-Ethyl-1,14-dihydroxy-12-(2-{4-[2-hydroxy-2-(3-t...)
Affinity DataIC50:  5.90nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079770(C32-O-Phenalkyl ether derivative of Ascomycin | CH...)
Affinity DataIC50:  7.20nMAssay Description:Concentration required for inhibition of serine/threonine protein phosphatase calcineurin (CAN)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079778(12-(2-{4-[2-(3,4-Difluoro-phenyl)-2-hydroxy-ethoxy...)
Affinity DataIC50:  7.30nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079779(17-Ethyl-1,14-dihydroxy-12-{2-[4-(2-hydroxy-2-naph...)
Affinity DataIC50:  7.30nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079780(12-(2-{4-[2-(3,5-Dimethyl-phenyl)-2-hydroxy-ethoxy...)
Affinity DataIC50:  7.90nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079774(12-(2-{4-[2-(3,5-Dimethyl-phenyl)-2-hydroxy-ethoxy...)
Affinity DataIC50:  8.70nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079781(12-(2-{4-[2-(3,4-Difluoro-phenyl)-2-hydroxy-ethoxy...)
Affinity DataIC50:  8.70nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiotensin-converting enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM21642((2S)-1-[(2S)-2-methyl-3-sulfanylpropanoyl]pyrrolid...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human ACE-mediated amyloid beta hydrolysisMore data for this Ligand-Target Pair
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079767(C32-O-Phenalkyl ether derivative of Ascomycin | C3...)
Affinity DataIC50:  14nMAssay Description:Concentration required for inhibition of serine/threonine protein phosphatase calcineurin (CAN)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein phosphatase 3 catalytic subunit alpha(Homo sapiens (Human))
Merck Research Laboratories

Curated by ChEMBL
LigandPNGBDBM50079777((E)-(1R,9S,12S,13R,14R,21S,23S,24R,25S,27R)-17-All...)
Affinity DataIC50:  15nMAssay Description:Inhibitory activity against Calcineurin (CaN phosphatase)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11459(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  24nMpH: 7.5 T: 2°CAssay Description:The enzyme was assayed with substrate GST-Rb in the presence of 10 uM ATP/[gamma-33P] ATP, and capturing the 33-P labeled reaction products on GSH-Se...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11460(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  48nMpH: 7.5 T: 2°CAssay Description:The enzyme was assayed with substrate GST-Rb in the presence of 10 uM ATP/[gamma-33P] ATP, and capturing the 33-P labeled reaction products on GSH-Se...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11458(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  50nMpH: 7.5 T: 2°CAssay Description:The enzyme was assayed with substrate GST-Rb in the presence of 10 uM ATP/[gamma-33P] ATP, and capturing the 33-P labeled reaction products on GSH-Se...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11460(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  52nMpH: 8.0 T: 2°CAssay Description:The biochemical activity of compounds was determined by incubation with specific enzyme and substrate in the presence 0.5 uM ATP/ [gamma-33P] ATP. Af...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11459(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  70nMpH: 8.0 T: 2°CAssay Description:The biochemical activity of compounds was determined by incubation with specific enzyme and substrate in the presence 0.5 uM ATP/ [gamma-33P] ATP. Af...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005641(CHEMBL3235416)
Affinity DataIC50:  100nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441574(CHEMBL2437163)
Affinity DataIC50:  170nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11458(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  226nMpH: 8.0 T: 2°CAssay Description:The biochemical activity of compounds was determined by incubation with specific enzyme and substrate in the presence 0.5 uM ATP/ [gamma-33P] ATP. Af...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441587(CHEMBL2437157)
Affinity DataIC50:  300nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441598(CHEMBL2437156)
Affinity DataIC50:  340nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441592(CHEMBL2437170)
Affinity DataIC50:  490nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441590(CHEMBL2437164)
Affinity DataIC50:  540nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005640(CHEMBL3235415)
Affinity DataIC50:  600nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005638(CHEMBL3235414)
Affinity DataIC50:  600nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441590(CHEMBL2437164)
Affinity DataIC50:  610nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441574(CHEMBL2437163)
Affinity DataIC50:  630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441586(CHEMBL2437153)
Affinity DataIC50:  670nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441593(CHEMBL2437173)
Affinity DataIC50:  700nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11461(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  720nMpH: 7.5 T: 2°CAssay Description:The enzyme was assayed with substrate GST-Rb in the presence of 10 uM ATP/[gamma-33P] ATP, and capturing the 33-P labeled reaction products on GSH-Se...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441587(CHEMBL2437157)
Affinity DataIC50:  730nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Lawrence Berkeley National Laboratory

LigandPNGBDBM11459(2,6,9-trisubstituted adenine derivative | 2-N-(4-a...)
Affinity DataIC50:  780nMpH: 7.5 T: 2°CAssay Description:The enzyme was assayed with substrate GST-Rb in the presence of 10 uM ATP/[gamma-33P] ATP, and capturing the 33-P labeled reaction products on GSH-Se...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441589(CHEMBL2437160)
Affinity DataIC50:  790nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441589(CHEMBL2437160)
Affinity DataIC50:  810nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441588(CHEMBL2437159)
Affinity DataIC50:  880nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441611(CHEMBL2437180)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441600(CHEMBL2437165)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441588(CHEMBL2437159)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441585(CHEMBL2437148)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441619(CHEMBL2437189)
Affinity DataIC50:  1.20E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 172 total ) | Next | Last >>
Jump to: