Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.60nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 3.10nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.5nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.60nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.60nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 5.40nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 6.30nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 9.40nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 15nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 17nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 35.2nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 40nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 48nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 170nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 175nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 250nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 260nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair