Compile Data Set for Download or QSAR
maximum 50k data
Found 952 with Last Name = 'liras' and Initial = 's'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350987(CHEMBL1818233)
Affinity DataKi:  0.5nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataKi:  0.570nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50301953((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Affinity DataKi:  0.660nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306288(4-(1-(cyclopropylmethyl)-3-(3-hydroxyphenyl)piperi...)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM82551(C18130 | CAS_105618-26-6 | NOR-BNI (HCI)2 | NORBNI)
Affinity DataKi:  0.850nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306298(CHEMBL595472 | N,N-diethyl-4-(4-(3-hydroxyphenyl)-...)
Affinity DataKi:  0.900nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350958(CHEMBL1818236)
Affinity DataKi:  1.10nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231895(CHEMBL4073486)
Affinity DataKi:  1.10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086359(CHEMBL147191 | N-Cyclohexylmethyl-2,2-dimethyl-3-m...)
Affinity DataKi:  1.20nMAssay Description:Inhibition of [3H]U-69,593 binding to human Opioid receptor kappa 1 expressed in HEK 293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306293(4-(1-((1H-imidazol-2-yl)methyl)-3-(3-hydroxyphenyl...)
Affinity DataKi:  1.20nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50000788((morphine)4-methyl-(1S,5R,13R,14S,17R)-12-oxa-4-az...)
Affinity DataKi:  1.20nMAssay Description:Inhibition of [3H]U-69,593 binding to human Opioid receptor kappa 1 expressed in HEK 293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedDrugBank

TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350976(CHEMBL1818341)
Affinity DataKi:  1.20nMAssay Description:Agonist activity at human kappa opioid receptor by GTPgamma S binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086361(3-(3-Hydroxy-phenyl)-2,2-dimethyl-3-methylamino-N-...)
Affinity DataKi:  1.30nMAssay Description:Inhibition of [3H]U-69,593 binding to human Opioid receptor kappa 1 expressed in HEK 293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231948(CHEMBL4066463)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMu-type opioid receptor(Rattus norvegicus (rat))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50000788((morphine)4-methyl-(1S,5R,13R,14S,17R)-12-oxa-4-az...)
Affinity DataKi:  1.40nMAssay Description:Inhibition of [3H]-DAMGO binding to rat Opioid receptor mu 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231947(CHEMBL4062134)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMu-type opioid receptor(Rattus norvegicus (rat))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086367(3-(3-Hydroxy-phenyl)-2,2-dimethyl-3-methylamino-N-...)
Affinity DataKi:  1.40nMAssay Description:Inhibition of [3H]-DAMGO binding to rat Opioid receptor mu 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMu-type opioid receptor(Rattus norvegicus (rat))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086361(3-(3-Hydroxy-phenyl)-2,2-dimethyl-3-methylamino-N-...)
Affinity DataKi:  1.40nMAssay Description:Inhibition of [3H]-DAMGO binding to rat Opioid receptor mu 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231898(CHEMBL4079909)
Affinity DataKi:  1.5nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMu-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350990(CHEMBL1818334)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human mu opioid receptor by GTPgamma S binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231899(CHEMBL4087789)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350956(CHEMBL1818234)
Affinity DataKi:  1.80nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306299(CHEMBL595473 | N,N-diethyl-4-(4-(3-hydroxyphenyl)-...)
Affinity DataKi:  1.80nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306297(4-(1-allyl-4-(3-hydroxyphenyl)piperidin-4-yl)-N,N-...)
Affinity DataKi:  1.90nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306287(3-(4-(4-(3-hydroxypentan-3-yl)phenyl)-1-(2-methylp...)
Affinity DataKi:  2nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350983(CHEMBL1818330)
Affinity DataKi:  2.20nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306290(4-(1-(cyclopropylmethyl)-3-(3-hydroxyphenyl)piperi...)
Affinity DataKi:  2.20nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306301(3-(1-(cyclopropylmethyl)-4-(4-(3-hydroxypentan-3-y...)
Affinity DataKi:  2.30nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350990(CHEMBL1818334)
Affinity DataKi:  2.5nMAssay Description:Agonist activity at human kappa opioid receptor by GTPgamma S binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350985(CHEMBL1818332)
Affinity DataKi:  2.60nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306291(CHEMBL595714 | N,N-diethyl-4-(3-(3-hydroxyphenyl)-...)
Affinity DataKi:  2.90nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086363(3-(Cyclopropylmethyl-methyl-amino)-3-(3-hydroxy-ph...)
Affinity DataKi:  2.90nMAssay Description:Inhibition of [3H]U-69,593 binding to human Opioid receptor kappa 1 expressed in HEK 293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350976(CHEMBL1818341)
Affinity DataKi:  3nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350973(CHEMBL1818337)
Affinity DataKi:  3.5nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306292(CHEMBL605735 | N,N-diethyl-4-(3-(3-hydroxyphenyl)-...)
Affinity DataKi:  3.5nMAssay Description:Displacement of [125I]diprenorphine from human delta opioid receptor expressed in CHO cells by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50086366(3-(3-Hydroxy-phenyl)-2,2-dimethyl-3-methylamino-N-...)
Affinity DataKi:  3.60nMAssay Description:Inhibition of [3H]U-69,593 binding to human Opioid receptor kappa 1 expressed in HEK 293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKappa-type opioid receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50350957(CHEMBL1818235)
Affinity DataKi:  3.70nMAssay Description:Displacement of [3H]diprenorphine from human kappa opioid receptor expressed in CHO cells after 1 hr by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM14768((R)-6,7-Dimethoxy-4-[3-(quinoxalin-2-yloxy)-pyrrol...)
Affinity DataKi:  4nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
Displayed 1 to 50 (of 952 total ) | Next | Last >>
Jump to: