Compile Data Set for Download or QSAR
maximum 50k data
Found 126 with Last Name = 'sperandio' and Initial = 'o'
TargetNeprilysin(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM21641(2-(2-benzyl-3-sulfanylpropanamido)acetic acid | CH...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human NEP-mediated amyloid beta hydrolysisMore data for this Ligand-Target Pair
TargetAngiotensin-converting enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM21642((2S)-1-[(2S)-2-methyl-3-sulfanylpropanoyl]pyrrolid...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human ACE-mediated amyloid beta hydrolysisMore data for this Ligand-Target Pair
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005641(CHEMBL3235416)
Affinity DataIC50:  100nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441574(CHEMBL2437163)
Affinity DataIC50:  170nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441587(CHEMBL2437157)
Affinity DataIC50:  300nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441598(CHEMBL2437156)
Affinity DataIC50:  340nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441592(CHEMBL2437170)
Affinity DataIC50:  490nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441590(CHEMBL2437164)
Affinity DataIC50:  540nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005638(CHEMBL3235414)
Affinity DataIC50:  600nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005640(CHEMBL3235415)
Affinity DataIC50:  600nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441590(CHEMBL2437164)
Affinity DataIC50:  610nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441574(CHEMBL2437163)
Affinity DataIC50:  630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441586(CHEMBL2437153)
Affinity DataIC50:  670nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441593(CHEMBL2437173)
Affinity DataIC50:  700nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441587(CHEMBL2437157)
Affinity DataIC50:  730nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441589(CHEMBL2437160)
Affinity DataIC50:  790nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441589(CHEMBL2437160)
Affinity DataIC50:  810nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441588(CHEMBL2437159)
Affinity DataIC50:  880nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441588(CHEMBL2437159)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441611(CHEMBL2437180)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441600(CHEMBL2437165)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441585(CHEMBL2437148)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441619(CHEMBL2437189)
Affinity DataIC50:  1.20E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441613(CHEMBL2437182)
Affinity DataIC50:  1.20E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441614(CHEMBL2437183)
Affinity DataIC50:  1.20E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441599(CHEMBL2437158)
Affinity DataIC50:  1.26E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441591(CHEMBL2437167)
Affinity DataIC50:  1.40E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441586(CHEMBL2437153)
Affinity DataIC50:  1.40E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005637(CHEMBL3235413)
Affinity DataIC50:  1.40E+3nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441585(CHEMBL2437148)
Affinity DataIC50:  1.50E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441593(CHEMBL2437173)
Affinity DataIC50:  1.60E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441601(CHEMBL2437166)
Affinity DataIC50:  1.60E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441596(CHEMBL2437147)
Affinity DataIC50:  1.60E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441617(CHEMBL2437186)
Affinity DataIC50:  1.70E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441612(CHEMBL2437181)
Affinity DataIC50:  1.70E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor V(Homo sapiens (Human))
Maastricht University

Curated by ChEMBL
LigandPNGBDBM50376425(CHEMBL1162108)
Affinity DataIC50:  1.81E+3nMAssay Description:Inhibition of factor 5a-mediated prothrombin activation in human plasma by prothrombinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441616(CHEMBL2437185)
Affinity DataIC50:  1.90E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441591(CHEMBL2437167)
Affinity DataIC50:  2.00E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441615(CHEMBL2437184)
Affinity DataIC50:  2.10E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441604(CHEMBL2437171)
Affinity DataIC50:  2.30E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor V(Homo sapiens (Human))
Maastricht University

Curated by ChEMBL
LigandPNGBDBM50376418(CHEMBL259312)
Affinity DataIC50:  2.50E+3nMAssay Description:Inhibition of human factor 5a light chain binding to immobilized phospholipid by surface plasmon resonance assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441602(CHEMBL2437168)
Affinity DataIC50:  2.80E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005636(CHEMBL3235412)
Affinity DataIC50:  2.90E+3nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (16 to 23) hydrolysis using ATTO 655-Cys-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Trp as substrate p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441592(CHEMBL2437170)
Affinity DataIC50:  2.90E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-degrading enzyme(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50005641(CHEMBL3235416)
Affinity DataIC50:  3.10E+3nMAssay Description:Inhibition of human recombinant IDE-mediated amyloid beta (1 to 40) hydrolysis preincubated for 10 mins measured after 30 mins by spectrophotometer a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441597(CHEMBL2437155)
Affinity DataIC50:  3.10E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441610(CHEMBL2437178)
Affinity DataIC50:  3.20E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441606(CHEMBL2437175)
Affinity DataIC50:  3.30E+3nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor V(Homo sapiens (Human))
Maastricht University

Curated by ChEMBL
LigandPNGBDBM50376418(CHEMBL259312)
Affinity DataIC50:  3.51E+3nMAssay Description:Inhibition of human recombinant factor 5a C2 domain binding to immobilized phospholipid by surface plasmon resonance assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor V(Homo sapiens (Human))
Maastricht University

Curated by ChEMBL
LigandPNGBDBM50376419(CHEMBL1162109)
Affinity DataIC50:  3.80E+3nMAssay Description:Inhibition of factor 5a-mediated prothrombin activation in human plasma by prothrombinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 126 total ) | Next | Last >>
Jump to: