Found 1 Enz. Inhib. hit(s) with Target = 'Cell division cycle 7-related protein kinase/Protein DBF4 homolog A' and Ligand = 'BDBM50135286'
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDC7/DBF4 using [[protein fragment, 39 aa]] as substrateMore data for this Ligand-Target Pair