Found 4 Enz. Inhib. hit(s) with Target = 'Cyclin-T1/Cyclin-dependent kinase 9' and Ligand = 'BDBM148264'
Affinity DataIC50: 197nMAssay Description:Inhibition of human CDK9/CyclinT1 by enzymatic radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15More data for this Ligand-Target Pair
Affinity DataIC50: 3.90E+3nMAssay Description:Inhibition of GST-tagged CDK9/CyclinT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as substr...More data for this Ligand-Target Pair