Compile Data Set for Download or QSAR
maximum 50k data
Found 1 Enz. Inhib. hit(s) with Target = 'Cyclin-T1/Cyclin-dependent kinase 9' and Ligand = 'BDBM50519553'
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50519553(CHEMBL4474633)
Affinity DataIC50:  11nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed