Compile Data Set for Download or QSAR
Report error Found 62 Enz. Inhib. hit(s) with all data for entry = 50039268
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324722BDBM50324722(CHEMBL1222096)
Affinity DataEC50:  0.0110nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324729BDBM50324729(CHEMBL1222174)
Affinity DataEC50:  0.0130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324728BDBM50324728(CHEMBL1222102)
Affinity DataEC50:  0.0140nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324712BDBM50324712(HSQGTFTSDYSKYLDEQAAKEFIAWLVKG | CHEMBL1222086)
Affinity DataEC50:  0.0150nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324713BDBM50324713(HSQGTFTSDYSKYLDEQAAKEFIAWLMNT | CHEMBL1222087)
Affinity DataEC50:  0.0260nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324721BDBM50324721(CHEMBL1222095)
Affinity DataEC50:  0.0280nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324715BDBM50324715(CHEMBL1222089)
Affinity DataEC50:  0.0280nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324731BDBM50324731(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR | CHEMBL1222074)
Affinity DataEC50:  0.0330nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324724BDBM50324724(CHEMBL1222098)
Affinity DataEC50:  0.0460nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324714BDBM50324714(CHEMBL1222088)
Affinity DataEC50:  0.0480nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324725BDBM50324725(CHEMBL1222099)
Affinity DataEC50:  0.0490nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324702BDBM50324702(CHEMBL1222076)
Affinity DataEC50:  0.0490nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324724BDBM50324724(CHEMBL1222098)
Affinity DataEC50:  0.0510nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324703BDBM50324703(CHEMBL1222077)
Affinity DataEC50:  0.0530nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324706BDBM50324706(CHEMBL1222080)
Affinity DataEC50:  0.0540nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324729BDBM50324729(CHEMBL1222174)
Affinity DataEC50:  0.0550nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324725BDBM50324725(CHEMBL1222099)
Affinity DataEC50:  0.0580nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324708BDBM50324708(CHEMBL1222082)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324713BDBM50324713(HSQGTFTSDYSKYLDEQAAKEFIAWLMNT | CHEMBL1222087)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324717BDBM50324717(CHEMBL1222091)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324716BDBM50324716(CHEMBL1222090)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324705BDBM50324705(CHEMBL1222079)
Affinity DataEC50:  0.0710nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324711BDBM50324711(CHEMBL1222085)
Affinity DataEC50:  0.0710nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50098571BDBM50098571(His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Ty...)
Affinity DataEC50:  0.0710nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324717BDBM50324717(CHEMBL1222091)
Affinity DataEC50:  0.0730nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324714BDBM50324714(CHEMBL1222088)
Affinity DataEC50:  0.0750nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324716BDBM50324716(CHEMBL1222090)
Affinity DataEC50:  0.0750nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324727BDBM50324727(CHEMBL1222101)
Affinity DataEC50:  0.0760nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324711BDBM50324711(CHEMBL1222085)
Affinity DataEC50:  0.0770nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324726BDBM50324726(CHEMBL1222100)
Affinity DataEC50:  0.0780nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324718BDBM50324718(CHEMBL1222092)
Affinity DataEC50:  0.0800nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324718BDBM50324718(CHEMBL1222092)
Affinity DataEC50:  0.0870nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324715BDBM50324715(CHEMBL1222089)
Affinity DataEC50:  0.0870nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324704BDBM50324704(CHEMBL1222078)
Affinity DataEC50:  0.100nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324707BDBM50324707(CHEMBL1222081)
Affinity DataEC50:  0.100nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324720BDBM50324720(CHEMBL1222094)
Affinity DataEC50:  0.110nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324707BDBM50324707(CHEMBL1222081)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324723BDBM50324723(CHEMBL1222097)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324706BDBM50324706(CHEMBL1222080)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324723BDBM50324723(CHEMBL1222097)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324709BDBM50324709(CHEMBL1222083)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324710BDBM50324710(CHEMBL1222084)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324732BDBM50324732(CHEMBL1222075)
Affinity DataEC50:  0.150nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324702BDBM50324702(CHEMBL1222076)
Affinity DataEC50:  0.170nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324719BDBM50324719(HAEGTFTSDVSSYLEERRAQDFVQWLMNT | CHEMBL1222093)
Affinity DataEC50:  0.180nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324727BDBM50324727(CHEMBL1222101)
Affinity DataEC50:  0.180nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324704BDBM50324704(CHEMBL1222078)
Affinity DataEC50:  0.230nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324726BDBM50324726(CHEMBL1222100)
Affinity DataEC50:  0.240nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324705BDBM50324705(CHEMBL1222079)
Affinity DataEC50:  0.260nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
TargetGlucagon receptor(Human)
Indiana University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50324712BDBM50324712(HSQGTFTSDYSKYLDEQAAKEFIAWLVKG | CHEMBL1222086)
Affinity DataEC50:  0.470nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/1/2013
Entry Details Article
PubMed
Displayed 1 to 50 (of 62 total ) | Next | Last >>
Jump to: