Compile Data Set for Download or QSAR
Report error Found 156 of affinity data for UniProtKB/TrEMBL: P06881
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50356281BDBM50356281(CHEMBL1910953)
Affinity DataKi:  0.0100nMAssay Description:Displacement of [125I]adrenomedullin form CGRP receptor in human SK-N-MC cell membrane by competitive binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50356281BDBM50356281(CHEMBL1910953)
Affinity DataKi:  0.0100nMAssay Description:Displacement of [125I]adrenomedullin form CGRP receptor in human SK-N-MC cell membrane by competitive binding assay in the absence of MgCl2More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50184069BDBM50184069(CHEMBL207197 | N-((R)-1-((S)-6-amino-1-oxo-1-(4-(p...)
Affinity DataKi:  0.0140nMAssay Description:Displacement of [125I]adrenomedullin form CGRP receptor in human SK-N-MC cell membrane by competitive binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50356282BDBM50356282(CHEMBL1910936)
Affinity DataKi:  0.0240nMAssay Description:Displacement of [125I]adrenomedullin form CGRP receptor in human SK-N-MC cell membrane by competitive binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 311886BDBM311886(US10166226, Example 1 | N-[(2R)-1-[4-(1H-imidazol-...)
Affinity DataKi:  0.0500nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312053BDBM312053(US10166226, Example 9 | 5-{1'-[(2R)-3-(7-methyl-1H...)
Affinity DataKi:  0.0500nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246717BDBM50246717(ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-amide | CHEM...)
Affinity DataEC50:  0.0500nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312050BDBM312050(US10166226, Example 6 | ethyl 5-{1'-[(2R)-3-(7-met...)
Affinity DataKi:  0.0630nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 311913BDBM311913(US10166226, Example 2 | N-[(2R)-1-[4-(4-methyl-1H-...)
Affinity DataKi:  0.0790nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312002BDBM312002(US10166226, Example 4 | N-{(2R)-3-(7-methyl-1H-ind...)
Affinity DataKi:  0.100nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312052BDBM312052(US10166226, Example 8 | N-{(2R)-3-(7-methyl-1H-ind...)
Affinity DataKi:  0.100nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50150463BDBM50150463(CHEMBL3771371)
Affinity DataIC50: 0.110nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2017
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50356282BDBM50356282(CHEMBL1910936)
Affinity DataIC50: 0.120nMAssay Description:Inhibition of human CGRP receptor expressed in huamn HEK293 cells coexpressing CLR/RAMP1 assessed as inhibition of CGRP-stimulated cAMP production af...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312049BDBM312049(US10166226, Example 5 | 4-(7-fluoro-2-oxo-1,2-dihy...)
Affinity DataKi:  0.126nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 311965BDBM311965(US10166226, Example 3 | N-{(2R)-3-(7-methyl-1H-ind...)
Affinity DataKi:  0.158nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 312051BDBM312051(US10166226, Example 7 | N-{(2R)-3-(7-methyl-1H-ind...)
Affinity DataKi:  0.158nMAssay Description:Human CGRP receptors (consisting of CRLR and RAMP1) expressed in insect Sf21 cell membrane homogenates were re-suspended in the binding buffer (10 mM...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/11/2019
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246690BDBM50246690(Ac-WVTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL503...)
Affinity DataIC50: 0.200nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50150464BDBM50150464(CHEMBL3771314)
Affinity DataIC50: 0.230nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2017
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126173BDBM126173(US8778957, 87)
Affinity DataKi:  0.340nM ΔG°:  -54.0kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246694BDBM50246694(Ac-WVTHQLAGLLSQSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL524...)
Affinity DataIC50: 0.530nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246691BDBM50246691(Ac-WVTH[Cit]LAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMB...)
Affinity DataIC50: 0.570nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246692BDBM50246692(Ac-WVTHRLAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2 | CHEMB...)
Affinity DataIC50: 0.580nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246687BDBM50246687(WVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 | CHEMBL500283)
Affinity DataIC50: 0.640nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246689BDBM50246689(Ac-VTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL5108...)
Affinity DataIC50: 0.710nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126176BDBM126176(US8778957, 84)
Affinity DataKi:  0.720nM ΔG°:  -52.2kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126178BDBM126178(US8778957, 76)
Affinity DataKi:  0.730nM ΔG°:  -52.1kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126170BDBM126170(US8778957, 3)
Affinity DataKi:  0.770nM ΔG°:  -52.0kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50224431BDBM50224431(N-[(3R,6S)-6-(2,3-difluorophenyl)-2-oxo-1-(2,2,2-t...)
Affinity DataKi:  0.780nMAssay Description:Displacement of [125I]adrenomedullin form CGRP receptor in human SK-N-MC cell membrane by competitive binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246709BDBM50246709(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[2-Nal...)
Affinity DataIC50: 0.790nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50025074BDBM50025074(CHEMBL2372188)
Affinity DataIC50: 0.850nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246698BDBM50246698(Ac-WVEHRLKGELSRKGGVV[hArg]KNFVPTDVGPFAF-NH2 | CHEM...)
Affinity DataIC50: 1nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50150396BDBM50150396(CHEMBL3769439)
Affinity DataIC50: 1.10nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2017
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246697BDBM50246697(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGPFAF-NH...)
Affinity DataIC50: 1.30nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50025097BDBM50025097(CHEMBL2372192)
Affinity DataIC50: 1.30nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246710BDBM50246710(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[Bip]A...)
Affinity DataIC50: 1.60nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246693BDBM50246693(Ac-WVTH[Cit]LAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2 | C...)
Affinity DataIC50: 1.70nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246688BDBM50246688(Ac-VTHRLAGLLSRSGGVVKNNFVPTDVGPFAF-NH2 | CHEMBL5093...)
Affinity DataIC50: 1.70nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246696BDBM50246696(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[1-Nal...)
Affinity DataIC50: 1.80nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126171BDBM126171(US8778957, 11)
Affinity DataKi:  1.80nM ΔG°:  -49.9kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246701BDBM50246701(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Thz]FA...)
Affinity DataIC50: 2nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246695BDBM50246695(Ac-WVTH[hArg]LAGLLS[hArg]SGGVVRKNFVPTDVGPFAF-NH2 |...)
Affinity DataIC50: 2.10nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50025073BDBM50025073(CHEMBL2372187)
Affinity DataIC50: 2.20nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246708BDBM50246708(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[1-Nal...)
Affinity DataIC50: 2.20nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50224431BDBM50224431(N-[(3R,6S)-6-(2,3-difluorophenyl)-2-oxo-1-(2,2,2-t...)
Affinity DataIC50: 2.20nMAssay Description:Inhibition of human CGRP receptor expressed in huamn HEK293 cells coexpressing CLR/RAMP1 assessed as inhibition of CGRP-stimulated cAMP production af...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/20/2012
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126177BDBM126177(US8778957, 88)
Affinity DataKi:  2.60nM ΔG°:  -49.0kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126172BDBM126172(US8778957, 19)
Affinity DataKi:  2.90nM ΔG°:  -48.7kJ/molepH: 7.4 T: 2°CAssay Description:Cells expressing recombinant human CL receptor/RAMP1 were washed with PBS and harvested in harvest buffer containing 50 mM HEPES, 1 mM EDTA and Compl...More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/8/2014
Entry Details
US Patent

TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50150450BDBM50150450(CHEMBL3769667)
Affinity DataIC50: 2.90nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2017
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50025075BDBM50025075(CHEMBL2372193)
Affinity DataIC50: 3.5nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246700BDBM50246700(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Aib]FA...)
Affinity DataIC50: 3.5nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetCalcitonin gene-related peptide 1(Human)
Merck Research Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50025076BDBM50025076(CHEMBL2372194)
Affinity DataIC50: 3.60nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
Displayed 1 to 50 (of 156 total ) | Next | Last >>
Jump to: