Compile Data Set for Download or QSAR
Report error Found 747 for UniProtKB: Q9NNY9
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK9/cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 525743BDBM525743(US11174252, Compound 38)
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/3/2022
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466217BDBM50466217(CHEMBL4287416)
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 126500BDBM126500(US8778951, 310 | US11591322, Compound NVP-2)
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/11/2021
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 525738BDBM525738(US11174252, Compound 33)
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/3/2022
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466226BDBM50466226(CHEMBL4293213)
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50363196BDBM50363196(CHEMBL1944698)
Affinity DataIC50: 3nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression systemMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724589BDBM724589(2-(morpholin-4-yl)-7-(trifluoromethyl)-N-({5-[6-(t...)
Affinity DataIC50: 3.09nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 525729BDBM525729(US11174252, Compound 24)
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/3/2022
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 525750BDBM525750(US11174252, Compound 437)
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/3/2022
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724595BDBM724595(2-(morpholin-4-yl)-N-({5-[6-(trifluoromethoxy)pyri...)
Affinity DataIC50: 4.14nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 50139171BDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 5nMAssay Description:TBDMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 525730BDBM525730(US11174252, Compound 25)
Affinity DataIC50: 5nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/3/2022
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724593BDBM724593(2-(morpholin-4-yl)-N-({5-[6-(trifluoromethoxy)pyri...)
Affinity DataIC50: 5.96nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466210BDBM50466210(CHEMBL4281048)
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724587BDBM724587(2-(morpholin-4-yl)-N-({5-[4-(trifluoromethoxy)phen...)
Affinity DataIC50: 7.59nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724585BDBM724585(2-(morpholin-4-yl)-N-({5-[4-(trifluoromethoxy)phen...)
Affinity DataIC50: 8.34nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50367676BDBM50367676(CHEMBL4160662)
Affinity DataKd:  8.60nMAssay Description:Binding affinity to human CDK13 (694 to 1039 residues)/CyclinK (1 to 267 residues) expressed in baculovirus infected in Sf9 cells by Biolayer interfe...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/21/2023
Entry Details
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466216BDBM50466216(CHEMBL4291684)
Affinity DataIC50: 9nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724586BDBM724586(2-(morpholin-4-yl)-8-(trifluoromethyl)-N-({5-[4-(t...)
Affinity DataIC50: 9.21nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466238BDBM50466238(CHEMBL4277623)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50367676BDBM50367676(CHEMBL4160662)
Affinity DataIC50: 10nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK13 (1 to 1512 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724596BDBM724596(2-(morpholin-4-yl)-7-(trifluoromethyl)-N-({5-[6-(t...)
Affinity DataIC50: 11.9nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50597426BDBM50597426(CHEMBL5169449)
Affinity DataIC50: 12nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 729623BDBM729623(US20250101023, Example 49)
Affinity DataIC50: 12nMAssay Description:TBDMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
7/31/2025
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466240BDBM50466240(CHEMBL4286005)
Affinity DataIC50: 12nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724590BDBM724590(N-{[5-(4-methoxyphenyl)-1H-imidazol-2-yl]methyl}-2...)
Affinity DataIC50: 12.3nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50433369BDBM50433369(CHEMBL2377825)
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/12/2014
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Human)
Nuvation Bio

US Patent
LigandChemical structure of BindingDB Monomer ID 50059889BDBM50059889(3-methoxy-2-methyl-4-methylamino-(2S,3S,4S,6R)-29-...)
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/12/2014
Entry Details Article
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466222BDBM50466222(CHEMBL4279576)
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466218BDBM50466218(CHEMBL4278245)
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724599BDBM724599(2-(morpholin-4-yl)-8-(trifluoromethyl)-N-({5-[6-(t...)
Affinity DataIC50: 15.1nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 729620BDBM729620(US20250101023, Example 46)
Affinity DataIC50: 16nMAssay Description:TBDMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
7/31/2025
Entry Details
US Patent

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466221BDBM50466221(CHEMBL4281710)
Affinity DataIC50: 17nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50594507BDBM50594507(CHEMBL5203891)
Affinity DataKd:  17nMAssay Description:Binding affinity to human CDK13 (694 to 1039 residues)/CyclinK (1 to 267 residues) expressed in baculovirus infected in Sf9 cells by Biolayer interfe...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/21/2023
Entry Details
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788188BDBM788188(US12473303, Compound H-APPAMP-045)
Affinity DataIC50: 18nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 729624BDBM729624(US20250101023, Example 50)
Affinity DataIC50: 19nMAssay Description:TBDMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
7/31/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788150BDBM788150(US12473303, Compound H-APPAMP-007)
Affinity DataIC50: 20nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 8131BDBM8131(N-[4-(propan-2-yl)phenyl]-4-{pyrazolo[1,5-a]pyrida...)
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) by LanthaScreen binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/18/2024
Entry Details
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788186BDBM788186(US12473303, Compound H-APPAMP-043)
Affinity DataIC50: 21nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50139171BDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 21nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50597425BDBM50597425(CHEMBL5194202)
Affinity DataIC50: 22nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 13/Cyclin-K(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50597424BDBM50597424(CHEMBL5187378)
Affinity DataIC50: 22nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/22/2023
Entry Details
PubMed
TargetCyclin-K(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466235BDBM50466235(CHEMBL4282838)
Affinity DataIC50: 22nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 738790BDBM738790(US20250145632, Example Z2)
Affinity DataKi:  22.7nMAssay Description:This experiment was used for determining the inhibition of the activities of CDK2, CDK7, CDK9 and CDK12 kinases by the compound. The kinase reaction ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
9/9/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788174BDBM788174(US12473303, Compound H-APPAMP-031)
Affinity DataIC50: 24nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788155BDBM788155(US12473303, Compound H-APPAMP-012)
Affinity DataIC50: 26nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 738791BDBM738791(US20250145632, Example Z5)
Affinity DataKi:  26.1nMAssay Description:This experiment was used for determining the inhibition of the activities of CDK2, CDK7, CDK9 and CDK12 kinases by the compound. The kinase reaction ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
9/9/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 724584BDBM724584(2-(morpholin-4-yl)-7-(trifluoromethyl)-N-({5-[4-(t...)
Affinity DataIC50: 26.3nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/30/2025
Entry Details
US Patent

TargetCyclin-K/Cyclin-dependent kinase 12(Human)
Deutsches Krebsforschungszentrum

US Patent
LigandChemical structure of BindingDB Monomer ID 788149BDBM788149(US12473303, Compound H-APPAMP-006)
Affinity DataIC50: 26.9nMAssay Description:(33PanQinase® Activity Assay) was used for measuring the kinase activity of the two protein kinases (CDK12/CDK7). All kinase assays were performed in...More data for this Ligand-Target Pair
Ligand Info
In Depth
Date in BDB:
3/8/2026
Entry Details

Displayed 1 to 50 (of 747 total ) | Next | Last >>
Jump to: