Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK9/cyclin K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression systemMore data for this Ligand-Target Pair
Affinity DataIC50: 3.09nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 4.14nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 5nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 5.96nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 7.59nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 8.34nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataKd: 8.60nMAssay Description:Binding affinity to human CDK13 (694 to 1039 residues)/CyclinK (1 to 267 residues) expressed in baculovirus infected in Sf9 cells by Biolayer interfe...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 9.21nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK13 (1 to 1512 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
Affinity DataIC50: 11.9nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 12.3nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 15.1nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Affinity DataIC50: 17nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataKd: 17nMAssay Description:Binding affinity to human CDK13 (694 to 1039 residues)/CyclinK (1 to 267 residues) expressed in baculovirus infected in Sf9 cells by Biolayer interfe...More data for this Ligand-Target Pair
Ligand Info
Ligand Info
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) by LanthaScreen binding assayMore data for this Ligand-Target Pair
Ligand Info
Affinity DataIC50: 21nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
Affinity DataIC50: 22nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
Affinity DataIC50: 22nMAssay Description:Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP b...More data for this Ligand-Target Pair
Affinity DataIC50: 22nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataKi: 22.7nMAssay Description:This experiment was used for determining the inhibition of the activities of CDK2, CDK7, CDK9 and CDK12 kinases by the compound. The kinase reaction ...More data for this Ligand-Target Pair
Ligand Info
Ligand Info
Affinity DataKi: 26.1nMAssay Description:This experiment was used for determining the inhibition of the activities of CDK2, CDK7, CDK9 and CDK12 kinases by the compound. The kinase reaction ...More data for this Ligand-Target Pair
Affinity DataIC50: 26.3nMAssay Description:For the assay 50 nanoL of a 100 fold concentrated solution of the test compound in DMSO was pipetted into either a black low volume 384 well microtit...More data for this Ligand-Target Pair
Ligand Info















































