Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA:cholesterol acyltransferase
LigandBDBM50051881
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28783
IC50 20±n/a nM
Citation Astles, PCAshton, MJBridge, AWHarris, NVHart, TWParrott, DPPorter, BRiddell, DSmith, CWilliams, RJ Acyl-CoA:Cholesterol O-acyltransferase (ACAT) inhibitors. 2. 2-(1,3-Dioxan-2-yl)-4,5-diphenyl-1H-imidazoles as potent inhibitors of ACAT. J Med Chem39:1423-32 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA:cholesterol acyltransferase
Name:Acyl-CoA:cholesterol acyltransferase
Synonyms:ACAT
Type:n/a
Mol. Mass.:35405.31
Organism:Oryctolagus cuniculus
Description:n/a
Residue:305
Sequence:
PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIF
VARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLP
TVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYI
VLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLF
APTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVL
VLCIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051881
NameBDBM50051881
Synonyms:1-{4-[2-(4,5-Diphenyl-1H-imidazol-2-yl)-5-methyl-[1,3]dioxan-5-yl]-butyl}-3,5-dimethyl-1H-pyrazole | CHEMBL30860
TypeSmall organic molecule
Emp. Form.C29H34N4O2
Mol. Mass.470.6059
SMILESCc1cc(C)n(CCCCC2(C)COC(OC2)c2nc(c([nH]2)-c2ccccc2)-c2ccccc2)n1 |(17.48,-4.71,;16.19,-5.55,;14.76,-4.99,;13.79,-6.2,;12.25,-6.13,;14.64,-7.49,;14.24,-8.98,;12.75,-9.39,;12.35,-10.86,;10.86,-11.26,;10.45,-12.74,;11.77,-13.51,;9.19,-13.16,;7.56,-12.54,;6.79,-13.89,;7.98,-13.47,;9.69,-14.08,;5.45,-13.12,;5.04,-11.63,;3.5,-11.56,;2.96,-12.98,;4.15,-13.96,;1.48,-13.4,;.38,-12.31,;-1.09,-12.7,;-1.49,-14.2,;-.39,-15.28,;1.08,-14.87,;2.66,-10.26,;3.36,-8.88,;2.52,-7.6,;.99,-7.69,;.29,-9.07,;1.13,-10.35,;16.12,-7.08,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a