BindingDB PrimarySearch

Found 173 with Last Name = 'bradshaw' and Initial = 'd'

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

Ki: 3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570295(CHEMBL4854124)

Ki: 4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570294(CHEMBL4855334)

Ki: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570317(CHEMBL4863915)

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570316(CHEMBL4864851)

Ki: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570314(CHEMBL4847048)

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Aryl hydrocarbon receptor(Rattus norvegicus)
Cardiff University

Curated by ChEMBL

BDBM50240990(2-(3,4-dimethoxyphenyl)-5-fluorobenzothiazole | 5-...)

Ki: 6.80nMAssay Description:Displacement of [3H]tetrachlorodibenzo-p-dioxin from aryl hydrocarbon receptor in CRL:WI rat liver cytosolMore data for this Ligand-Target Pair

PDB Reactome pathway
UniProtKB/SwissProt
B.MOAD GoogleScholar

Purchase CHEMBL PC cid PC sid Similars

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570301(CHEMBL4868287)

Ki: 7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570308(CHEMBL4863865)

Ki: 7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570302(CHEMBL4853628)

Ki: 8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570309(CHEMBL4868954)

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570299(CHEMBL4879020)

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570320(CHEMBL4863852)

Ki: 9nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570296(CHEMBL4863124)

Ki: 10nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570304(CHEMBL4860925)

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50425005(CHEMBL2312188)

Ki: 11nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

CHEMBL MMDB PC cid PC sid PDB Similars

Details Article PubMed PDB

3D Structure (crystal)

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570297(CHEMBL4847674)

Ki: 12nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50425005(CHEMBL2312188)

Ki: 12nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

CHEMBL MMDB PC cid PC sid PDB Similars

Details Article PubMed PDB

3D Structure (crystal)

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570309(CHEMBL4868954)

Ki: 14nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570317(CHEMBL4863915)

Ki: 16nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570303(CHEMBL4864728)

Ki: 19nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570300(CHEMBL4849252)

Ki: 20nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570321(CHEMBL4851366)

Ki: 21nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570310(CHEMBL4876861)

Ki: 22nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570295(CHEMBL4854124)

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570315(CHEMBL4845688)

Ki: 25nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570313(CHEMBL4868705)

Ki: 32nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570298(CHEMBL4875788)

Ki: 34nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570311(CHEMBL4867016)

Ki: 40nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570322(CHEMBL4850846)

Ki: 43nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570314(CHEMBL4847048)

Ki: 44nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570316(CHEMBL4864851)

Ki: 45nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570318(CHEMBL4856525)

Ki: 47nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570306(CHEMBL4873661)

Ki: 49nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570315(CHEMBL4845688)

Ki: 52nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570320(CHEMBL4863852)

Ki: 55nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570307(CHEMBL4852571)

Ki: 62nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM8054(2-Anilino-4-(thiazol-5-yl)pyrimidine deriv. 25 | 4...)

Ki: 70nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

CHEMBL DrugBank MMDB PC cid PC sid PDB Patents Similars

Details Article PubMed DrugBank
MMDB
PDB

3D Structure (crystal)

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570298(CHEMBL4875788)

Ki: 87nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570301(CHEMBL4868287)

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570302(CHEMBL4853628)

Ki: 89nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570312(CHEMBL4851014)

Ki: 91nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570305(CHEMBL4876374)

Ki: 95nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570294(CHEMBL4855334)

Ki: 107nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570308(CHEMBL4863865)

Ki: 125nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570311(CHEMBL4867016)

Ki: 128nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570319(CHEMBL4871982)

Ki: 187nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570321(CHEMBL4851366)

Ki: 248nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570313(CHEMBL4868705)

Ki: 281nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL

BDBM50570296(CHEMBL4863124)

Ki: 444nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair

PDB MMDB NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar

PC cid PC sid

Details Article PubMed

Displayed 1 to 50 (of 173 total ) | Next | Last >>

Filter my 173 hits

Targets 13▿
- Cyclin-A2/Cyclin-dependent kinase 2 31
- Cyclin-T1/Cyclin-dependent kinase 9 30
- Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform 19
- Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform 19
- Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform 19
- Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform 19
- Dipeptidyl peptidase 4 17
- Cytochrome P450 1A1 4
- Prostaglandin G/H synthase 1/2 4
- Cyclin-H/Cyclin-dependent kinase 7 3
- Cyclin-dependent kinase/G2/mitotic-specific cyclin- 1 3
- C-C chemokine receptor type 5 3
- Aryl hydrocarbon receptor 2
- ...
Publications 5▿
- J Med Chem 60: 1534-1554 (2017) 96
- Eur J Med Chem 214: (2021) 67
- J Med Chem 49: 3973-81 (2006) 4
- J Med Chem 34: 772-7 (1991) 4
- J Med Chem 51: 5135-9 (2008) 2
Institutions 4▿
- University Park Nottingham 96
- University Of Nottingham 71
- Roche Products 4
- Cardiff University 2
Affinity: 0.63 to 6.5E+6 nM▿
- Ki 68
- IC50 102
- Kd 3
- Affinity ≤ nM
Xtal structures: 6
Docked structures: 1
Catalog Cmpds: 9