Compile Data Set for Download or QSAR
Report error Found 101 of affinity data for UniProtKB/TrEMBL: O43603
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 392076BDBM392076(US10301272, Example 7/9)
Affinity DataIC50: 0.190nMAssay Description:Displacement of [125I]-endothelin-1 from human recombinant GAL2 receptor after 120 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/27/2020
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307256BDBM50307256(Gal(1-13)-Std I | CHEMBL604373 | GWTLNSAGYLLGPrPKP...)
Affinity DataKi:  0.600nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85068BDBM85068(Gal(1-13)-Std I)
Affinity DataKi:  0.630nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataIC50: 0.800nMAssay Description:Binding affinity to human GAL2 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataKi:  0.900nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85070BDBM85070(Galanin, Porcine)
Affinity DataKi:  0.950nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273369BDBM50273369(CHEMBL526003 | Galanin (1-13)-SP-(5-11) | galantid...)
Affinity DataKd:  1nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85073BDBM85073(CAS_3043476 | NSC_3043476 | Galantide (M15))
Affinity DataKi:  1.07nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273369BDBM50273369(CHEMBL526003 | Galanin (1-13)-SP-(5-11) | galantid...)
Affinity DataKi:  1.10nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307255BDBM50307255(GWTLNSAGYLLGPRHYINLITRQRY-CONH2 | CHEMBL592413)
Affinity DataKi:  1.40nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85168BDBM85168(M32)
Affinity DataKi:  1.45nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307254BDBM50307254(M40 | CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2)
Affinity DataKi:  1.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85200BDBM85200(Galanin rat | Galanin (1-19), rat)
Affinity DataKi:  1.62nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307252BDBM50307252(WTLNSAGYLL-CONH2 | CHEMBL578710)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273368BDBM50273368(WTLNSAGYLL | CHEMBL506210)
Affinity DataKd:  1.80nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273370BDBM50273370(CHEMBL503473 | M35 | Galanin (1-13)-bradikinin(2-9...)
Affinity DataKi:  1.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273370BDBM50273370(CHEMBL503473 | M35 | Galanin (1-13)-bradikinin(2-9...)
Affinity DataKi:  1.95nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273370BDBM50273370(CHEMBL503473 | M35 | Galanin (1-13)-bradikinin(2-9...)
Affinity DataKd:  2nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273366BDBM50273366(GWTLNSAGYLLGPHAVGNHRSFSDKNGLT | CHEMBL499179)
Affinity DataKd:  2.30nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85072BDBM85072(Galanin, Human)
Affinity DataKi:  2.34nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataKi:  2.40nMAssay Description:Binding affinity to human GAL2 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataIC50: 2.60nMAssay Description:Binding affinity to human GAL2 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50208989BDBM50208989(CHEMBL506553)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]galanin from human recombinant GAL2 receptor expressed in CHO cells measured after 120 mins by scintillation counting methodMore data for this Ligand-Target Pair
In Depth
Date in BDB:
9/3/2018
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 85069BDBM85069(Galanin Porcine 2-29 | Galanin (2-29), rat)
Affinity DataKi:  2.88nMMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307254BDBM50307254(M40 | CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2)
Affinity DataKi:  4.07nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273367BDBM50273367(Galanin (1-16), rat | Galanin (1-16), porcine | CH...)
Affinity DataKd:  5nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273367BDBM50273367(Galanin (1-16), rat | Galanin (1-16), porcine | CH...)
Affinity DataKi:  5.37nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307253BDBM50307253(WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 | CHEMBL592415)
Affinity DataKi:  9.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273351BDBM50273351(GWTLNSAGYLLGPHAV-NH2 | CHEMBL508083)
Affinity DataKi:  13nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293029BDBM50293029((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Affinity DataKi:  14nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293030BDBM50293030((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Affinity DataKi:  15nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273359BDBM50273359(CHEMBL526500)
Affinity DataKi:  15nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293025BDBM50293025((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Affinity DataKi:  15nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50426597BDBM50426597(CHEMBL2324950)
Affinity DataKi:  16nMAssay Description:Displacement of euporium-galanin from human GalR2 after 1.5 hrs by DELFIA assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
9/24/2013
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307258BDBM50307258([N-Ac,des-Sar]Gal-B2 | CHEMBL578317)
Affinity DataKi:  16nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293028BDBM50293028((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Affinity DataKi:  16nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273360BDBM50273360([Sar1Gly]GAL-B2 | (S)-N-((S)-6-amino-1-((S)-6-amin...)
Affinity DataKi:  18nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293027BDBM50293027((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Affinity DataKi:  18nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307259BDBM50307259([N-Me,des-Sar]Gal-B2 | CHEMBL604991)
Affinity DataKi:  20nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293024BDBM50293024((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Affinity DataKi:  21nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273354BDBM50273354(CHEMBL525755)
Affinity DataKi:  22nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273360BDBM50273360([Sar1Gly]GAL-B2 | (S)-N-((S)-6-amino-1-((S)-6-amin...)
Affinity DataKi:  23nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50293023BDBM50293023((Sar)WTLNSAGYLLGPKKKK | CHEMBL508036)
Affinity DataKi:  24nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/25/2010
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273353BDBM50273353((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Affinity DataKi:  24nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273356BDBM50273356(CHEMBL504914)
Affinity DataKi:  28nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307257BDBM50307257([Sar1Ala]GAL-B2 | CHEMBL578910)
Affinity DataKi:  35nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273358BDBM50273358(Gal-B5 | (S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-...)
Affinity DataKi:  48nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273358BDBM50273358(Gal-B5 | (S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-...)
Affinity DataKi:  48nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273361BDBM50273361((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  51nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/18/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
Phenex Pharmaceuticals

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307250BDBM50307250(GalB2 | CHEMBL578514)
Affinity DataKi:  52nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
Displayed 1 to 50 (of 101 total ) | Next | Last >>
Jump to: